Loading...
HomeMy WebLinkAboutCAG2021-223 - Original - Lakeside Industries, Inc. - S. 212th Street Preservation - 05/06/2021ApprovalOriginator:Department: Date Sent:Date Required: Authorized to Sign: Director or Designee Mayor Date of Council Approval: Grant? Yes No Type:Review/Signatures/RoutingDate Received by City Attorney: Comments: Date Routed to the Mayor’s Office: Date Routed to the City Clerk’s Office:Agreement InformationVendor Name:Category: Vendor Number:Sub-Category: Project Name: Project Details: Agreement Amount: Start Date: Basis for Selection of Contractor: Termination Date: Local Business? Yes No* Business License Verification: Yes In-Process Exempt (KCC 5.01.045) If meets requirements per KCC 3.70.100, please complete “Vendor Purchase-Local Exceptions” form on Cityspace. Notice required prior to disclosure? Yes No Contract Number: Agreement Routing Form For Approvals, Signatures and Records Management This form combines & replaces the Request for Mayor’s Signature and Contract Cover Sheet forms. (Print on pink or cherry colored paper) Visit Documents.KentWA.gov to obtain copies of all agreementsadccW22373_1_20 Budget Account Number: Budget? Yes No Dir Asst: Sup/Mgr: Dir/Dep: rev. 200821 FOR CITY OF KENT OFFICIAL USE ONLY (Optional) * Memo to Mayor must be attached CAG2021-223 DATE: April 20, 2021 TO: Kent City Council SUBJECT: South 212th Street Preservation – 72nd Avenue South to 84th Avenue South (East Valley Highway) Bid - Award MOTION: Award the South 212th Street Preservation - 72nd Avenue South to 84th Avenue South (East Valley Highway) Project Bid to Lakeside Industries, Inc. in the amount of $1,859,868.10 and authorize the Mayor to sign all necessary documents, subject to final terms and conditions acceptable to the City Attorney and Public Works Director. SUMMARY: The project consists of a grind and overlay of the pavement on South 212th Street from the concrete pavement at 72nd Avenue South to 84th Avenue South (East Valley Highway). This project will also include curb ramp upgrades and driveway repairs to comply with Americans with Disabilities Act requirements. The bid opening for the South 212th Street Preservation - 72nd Avenue South to 84th Avenue South (East Valley Highway) Project was held on April 13, 2021 with three bids received. The lowest responsible and responsive bid was submitted by Lakeside Industries, Inc. in the amount of $1,859,868.10. Bid Tab Summary 01.Lakeside Industries, Inc. $1,859,868.10 02.Tucci & Sons, Inc.$1,893,753.25 03.ICON Materials $1,976,062.37 BUDGET IMPACT: This project received a grant from the Puget Sound Regional Council for $1.4 million and the remaining funds will come from the City’s B&O taxes. SUPPORTS STRATEGIC PLAN GOAL: Evolving Infrastructure - Connecting people and places through strategic investments in physical and technological infrastructure. Sustainable Services - Providing quality services through responsible financial management, economic growth, and partnerships. ATTACHMENTS: 1. 212th St Preservation Bid Tab (PDF) CITY OF KENT KING COUNTY, WASHINGTON KENT SPECIAL PROVISIONS FOR S. 212th St. Preservation 72nd Ave. S. to 84th Ave. S. (East Valley Highway) Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 BIDS ACCEPTED UNTIL April 13, 2021 10:00 A.M. BID OPENING IMMEDIATELY FOLLOWING DELIVER TO CITY OF KENT, CITY HALL 220 4th Avenue S., Kent, WA 98032-5895 CHAD BIEREN, P.E. PUBLIC WORKS DIRECTOR CITY OF KENT KING COUNTY, WASHINGTON KENT SPECIAL PROVISIONS FOR S. 212th St. Preservation 72nd Ave. S. to 84th Ave. S. (East Valley Highway) Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 BIDS ACCEPTED UNTIL April 13, 2021 10:00 A.M. BID OPENING IMMEDIATELY FOLLOWING DELIVER TO CITY OF KENT, CITY HALL 220 4th Avenue S., Kent, WA 98032-5895 CHAD BIEREN, P.E. PUBLIC WORKS DIRECTOR BIDDER'S NAME l>e /N> /ile CITY OF KENT KING COUNTY, WASHTNGTON KENT SPECIAL PROVISIONS FOR S' 212th St, Preservation 72nd Ave. S. to 84th Ave. S' (East Valley HighwaY) Federal Aid Number: STPUL-125O(OO9) Project Number: 19-3OO3 BIDS ACCEPTED UNTIL April L3t 2O2t 1O:OO A'M. BID OPENING IMMEDIATELY FOLLOWING crrY orffi?rY HALL 22O 4th Avenue S., Kent, WA 98032-5895 CHAD BTEREN, P.E. INTERIM PUBLIC WORKS DIRECTOR KENT WASHINGTON General Table of Contents Section 1: Bid Documents Section 2: Contract Documents Section 3: Special Provisions Appendices: Kent Standard Plans WSDOT Standard Plans Traffic Control Plans Project Sign Contractor’s Right of Entry Agreement BNSF Roadway Surfacing Agreement Specification - Retroreflective and Skid Resistant Bike Lane Green Preformed Thermoplastic Pavement Markings Prevailing Wage Rates Bid Document Contents Invitation to Bid ................................................................................... 1 Information for Bidders ......................................................................... 3 Contractor Compliance Statement ........................................................... 6 Declaration – City of Kent Equal Employment Opportunity Policy .................. 7 Administrative Policy 1.2 – Minority and Women Contractors................... 8 City of Kent Equal Employment Opportunity Compliance Statement .............. 9 Proposal ............................................................................................. 10 Proposal Signature Page ........................................................................ 23 Bid Bond Form ..................................................................................... 24 Contractor’s Qualification Statement ........................................................ 25 Statement that Bidder Has Not Been Disqualified ....................................... 28 Certification of Compliance with Wage Payment Statutes ........................ 29 Subcontractor List (over $1 million) – HVAC, Plumbing, and Electrical ........... 30 Subcontractor List (over $1 million) – Structural Steel Installation and Rebar Installation ................................................................................. 31 Local Agency Subcontractor List (271-015A) ............................................. 32 Combined Declaration Form (Non-Collusion, Minimum Wage) ...................... 33 Non-Collusion Declaration (272-036I) ...................................................... 34 Local Agency Certification for Federal-Aid Contracts (272-040A) .................. 35 Disadvantaged Business Enterprise (DBE) Bid Item Breakdown Form (272-054) ........................................................................................... 37 Disadvantaged Business Enterprise Utilization Certification (272-056) ........................................................................................... 39 Disadvantaged Business Enterprise (DBE) Trucking Credit Form (272-058) ........................................................................................... 42 Disadvantaged Business Enterprise Written Confirmation Document (422-031) ........................................................................................... 44 Required Contract Provisions Federal-Aid Construction Contracts (FHWA-1273) ...................................................................................... 45 Proposal for Incorporating Recycle Materials into the Project ....................... 68 Change Order ...................................................................................... 69 Bidder’s Checklist ................................................................................. 71 1 INVITATION TO BID Notice is hereby given that the City of Kent, Washington, will receive sealed bids at the City Clerk’s office through April 13, 2021 up to 10:00 a.m. as shown on the clock on the east wall of the City Clerk’s Office on the first floor of City Hall, 220 4th Avenue South, Kent, Washington. All bids must be properly marked and sealed in accordance with this “Invitation to Bid.” Bids must be delivered and received at the City Clerk’s office by the above-stated time, regardless of delivery method, including U.S. Mail. All bids will be opened and read publicly aloud immediately following 10:00 a.m. for the City of Kent project named as follows: S. 212th St. Preservation 72nd Ave. S. to 84th Ave. S. (East Valley Highway) Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The City of Kent will conduct the bid opening at the time and date as scheduled, however, due to the coronavirus disease 2019 (COVID-19) and its impacts the bid opening process will take place as follows: Bidders shall call the City Clerk at (253) 856-5725 to drop off bids. The City Clerk will read the bids out loud from the Clerk’s office. Individuals can stand in the lobby outside the Clerk’s office during the bid opening to hear the bid results, but must stand 6 feet or more apart. The project consists of planing 33,000 square yards of bituminous pavement, paving 6,500 tons of HMA Cl ½”, PG 58V-22, reconstructing 12 curb ramps to ADA standards, reconstructing 3 driveways, installing 75 vehicle detection loops, 275 square yards of sidewalk repairs, 26,000 feet of temporary pavement markings,13,000 feet of permanent channelization, and other work, all in accordance with the Contract Plans, Kent Special Provisions, and WSDOT Standard Specifications. Please note: this project has two railroad crossings. The contractor shall meet the requirements put forth in the right of entry permits issued by UPRR and BNSF Railroad Companies. The City of Kent has determined the project is essential pursuant to the Governor Inslee issued Proclamation 20-25. Should a contract be executed and this Proclamation or a similar proclamation be in place, specialized plans and protocols must be established and implemented to meet the social distancing and sanitation measures set forth by the United States Department of Labor or the Washington State Department of Health. It is the contractor’s responsibility to implement these measures. The Engineer’s estimate for this project is approximately $1,800,000 - $2,000,000. The DBE goal for this project is 18%. Bid documents may be obtained by contacting City of Kent Engineering Department, Nancy Yoshitake at 253-856-5508. For technical questions, please call Drew Holcomb at 253-561-1587. Bids must be clearly marked “Bid” with the name of the project on the outside of the envelope, addressed to the City Clerk, 220 4th Avenue South, Kent, WA 98032-5895. Only sealed bids will be accepted. No facsimiles or electronic submittals will be considered. 2 Each bid shall be in accordance with the plans and specifications and other contract documents now on file in the office of the City Engineer, City of Kent, Washington. Plans and specifications can also be downloaded at no charge at KentWA.gov/doing- business/bids-procurement. Copies of the WSDOT Standard Specifications are available for perusal only. A cashier’s check, cash or surety bond in the amount of 5% of the bid must be included with the bid. The City of Kent reserves the right to reject any and all bids on any or all schedules or alternates or to waive any informalities in the bidding and shall determine which bid or bidders is the most responsive, satisfactory and responsible bidder and shall be the sole judge thereof. Note: The award of the contract will not occur until the City of Kent has reviewed all bids for responsiveness and responsibility determinations and the Kent City Council has formally awarded the contract. No plea of mistake in the bid shall be available to the bidder for the recovery of his/her deposit or as a defense to any action based upon the neglect or refusal to execute a contract. Bidders must submit with their initial bid a signed statement as to whether they have previously performed work subject to the President’s Executive Order No. 11246. No bidder may withdraw his/her bid for a period of sixty (60) days after the day of bid opening. The (Local Agency) in accordance with Title VI of the Civil Rights Act of 1964, 78 Stat. 252, 42 USC 2000d to 2000d-4 and Title 49, Code of Federal Regulations, Department of Transportation, Subtitle A, Office of the Secretary, Part 21, Nondiscrimination in Federally-Assisted Programs of the Department of Transportation issued pursuant to such Act, hereby notifies all bidders that it will affirmatively ensure that in any contract entered into pursuant to this advertisement, disadvantaged business enterprises as defined at 49 CFR Part 26 will be afforded full opportunity to submit bids in response to this invitation and will not be discriminated against on the grounds of race, color, national origin, or sex in consideration for an award. Dated this 22nd day of March, 2021. BY: Kimberley A. Komoto, City Clerk Published in Daily Journal of Commerce on March 23, 30, and April 6, 2021. 1 INFORMATION FOR BIDDERS Also see the Standard Specifications and the APWA Special Provisions for additional information. Bidders shall be qualified by ability, experience, financing, equipment, and organization to do the work called for in the Contract. The City reserves the right to take whatever action it deems necessary to ascertain the ability of the Bidder to pefform the work satisfactorily. This action includes the City's review of the qualification information in the bid documents. The City will use this qualification data in its decision to determine whether the lowest responsive bidder is also responsible and able to perform the contract work. If the City determines that the lowest bidder is not the lowest responsive and responsible bidder, the City reserves its unqualified right to reject that bid and award the contract to the next lowest bidder that the City, in its sole judgment, determines is also responsible and able to perform the contract work (the "lowest responsive and responsible bidder"). Upon awarding the Contract, the City shall supply to the Contractor, for its own use, up to ten (10) copies of the Plans and Kent Special Provisions. Additional copies can be purchased from the City at the price specified by the City or in the Invitation to Bid, Because of the varying soil composition and ground water levels encountered in various areas and at different seasons of the year, the city makes no representation of such conditions as they may pertain to this project. The Contractor shall be responsible for any and all cribbing, sheet piling, dewatering, or other construction methods or procedures that may be necessary to completl the project, and additional compensation therefore will not be allowed unless otherwise specified in this document Prospective bidders may obtain Bid Documents and a "Bid proposal', for the advertised project from the City upon furnishing a non-refundable payment as specified in the "Invitation to Bid." Bid Documents may be requested by mail, orpicked up at the Public Works Engineering Department, 400 West Gowe Street, Second Floor, Kent, Washington 98032. All blanks in the proposal forms must be appropriatery fiiled in. Proposal must contain original signature pages. Facsimites are not acceptable and are considered non-responsive submittals. Certified checks are not accepted for bid deposit. All bids must be sealed and delivered in accordance with the "Invitation to Bid." Bids must be received at the City Clerk's office by the stated time, regardless of delivery method, including U.S. Mail. 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 2 3 4 5 6 7 3 March 22,202L I No person, firm or corporation shall be allowed to make, or file, or be interested in more than one bid for the same work unless alternate bids are specifically called for; however, a person, firm, or corporation that has submitted a subproposal to a bidder, or that has quoted prices of materials to a bidder is not tneieOy disqualified from submitting a subproposal or quoting prices to other bidders or from making a prime proposal. The City also reserves the right to include or omit any or all schedules or alternates of the Proposal and will award the Contract to the lowest responsive, responsible bidder based on the total bid amount, including schedules or alternates selected bY the CitY' A bidder who wished to claim error after the Bids have been opened and tabulated shall submit a notarized affidavit signed by the Bidder, accompanied by original work sheets used in the preparation of the Bid, requesting relief from the resionsibilities of Award. The affidavit shall describe the specific error(s) and ."riify that the work sheets are the originals used in the preparation of the Bid. The affidavit and the work sheets shall be submitted to the Engineer no later than 5:00 p.m. on the first business day after Bid opening, or the claim will not be considered. The Engineer will review the certified work sheets, to determine validity of the claimed error, and make a recommendation to the City' If the City concuis in the claim of error, the Bidder will be relieved of responsibility, and the Bid Deposit of the Bidder will be returned. Thereafter, at the discretion of the City, all Bids may be rejected or award made to the next lowest responsive, responsible Bidder. The form of contract that the successful bidder, as the Contractor, will be required to execute, and the forms and the amount of surety bonds that it will be reduireO to furnish it tne time of execution of the contract are included in the bid documents and should be carefully examined. The contract and the Surety Bonds will be executed in two (2) original counterpafts. Within 1O calendar days after the award date, the successful bidder shall return the signed City prepared contract, insurance certification as required by t-he contrait, ind a satisfactory bond as required by law and Seition f -OS.+. If the successful bidder fails to provide these documents within this lo-day period, the City may, at its sole discretion, reduce the time for completion of the contract work by one calendar day for each calendar day after this 10-day period that the successful bidder fails to provide all required documents. Until the City executes a contract, no proposal shall bind the City nor shall any work begin within the project limits or within City-furnished sites. The Contractor shall beJr all risks for any work begun outside such areas and for any materials ordered before the contract is executed by the City. No claim for delay shall be granted to the Contractor due to his failure to submit the required documents to the City in accordance with this schedule. 9 10 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 4 l'4arch 22,202L 11. Any decision made bythe City regarding the award and execution of the contract or bid rejection shall be conclusive subjectto the scope of judicial review permitted under Washington State Law. Such review, if any, shall be timely filed in the King County Superior Court, located in Kent, Washington. L2. The Contractor shall include all costs of doing the work within the bid item prices. If the contract plans, contract provisions, addenda, or any other paft of the contract require work that has no bid item price in the proposal form, the entire cost of labor and materials required to perform that work shall be incidental and included with the bid item prices in the contract. 13. Refer to the insurance requirements in Section L-07.18, which constitute the Contractor's insurance requirements for this project. L4. Bidders must complete WSDOT Form 272-056 (Disadvantaged Business Enterprise Utilization Ceftification) which is included in the Bid Package. Thisproject has a L8o/o DBE goal, 15.Bidders must have each Disadvantaged Business Enterprise (DBE) sub, that has been listed on the Disadvantaged Business Enterprise Utilization Certification(Dor Form 272-056), complete a Local Agency Disadvantaged Business Enterprise (DBE) Written Confirmation Document (DOT Form 422-A3L), which is included in the bid package. 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5 March 22,202L CONTRACTOR COMPLIANCE STATEM ENT (President's Executive Order # LL246) .2.oLl This statement relates to a proposed contract with the City of Kent named S. 212th St. Preservation 72nd Ave. S' to 84th Ave. S. (East Valley Highway) Federal Aid Number: STPUL-l25O(OO9) Project Number: 19-3OO3 D 1. I I am the undersigned bidder or prospective contractor. I represent that - X have,have not, participated in a previous contract or subcontract subject to the President's Executive Order #LL246 (regarding equal employment opportunity) or a preceding similar Executive order. l*Vt-st>z l^l} lNL. NAME OF BIDDER U\r Ptro> /"^,RBY SIG RE/TITLE tttot *, >slf-- br CD{ tNVTaN ,,//fi 8p41- ADDRESS (Note to Bidders: The information required in this Compliance Statement is informational onlY) 212th st, PreservationlHolcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 6 March 22,202L DECLARATION crTY oF KENT EQUAL EMPLOYMENT OPPORTUNITY pOLICy The City of Kent is committed to conform to Federal and State laws regarding equal oppoftunity. As such, all contractors, subcontractors and suppliers who perform work with relation to this contract shall comply with the regulations of the City's equal employment opportunity policies. The following questions specifically identify the requirements the City deems necessary for any contractor, subcontractor or supplier on this specific contract to adhere to. An affirmative response is required on all of the following questions for this contract to be valid and binding. If any contractor, subcontractor or supplier willfully misrepresents themselves with regard to the directives outlined, it will be considered a breach of contract and it will be at the City's sole determination regarding suspension or termination for all or part of the contract; The questions are as follows: 1. I have read the attached city of Kent administrative policy number 1.2. 2. During the time of this contract, I will not discriminate in employment on the basis of sex, race, color, national origin, age, or the presence of all sensory, mental orphysical disability. 3. During the time of this contract, the prime contractor will provide a written statement to all new employees and subcontractors indicating commitment as an equal opportunity employer. 4. During the time of the contract I, the prime contractor, will actively consider hiring and promotion of women and minorities. 5. Before acceptance of this contract, an adherence statement will be signed by me, the Prime Contractor, that the Prime Contractor complied with the requirements as set fofth above. By signing below, I agree to fulfill the five requirements referenced above By Ctai For It>t, t t lb tt t c. Title:Q ao: {wrr* Date:D+- v,w7r\ 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 7 Marcn 22,202L CITY OF KENT ADMINISTRATIVE POLICY NUMBER: T.2 EFFECTIVE DATE: January 1, 1998 SUBJECT: POLICY: Equal employment opportunity requirements for the City of Kent will conform to federal and state laws. All contractors, subcontractors, consultants and suppliers of the City must guarantee equal emptoyment opportunity within their organization and, if holding contracts with the City amounting to $10,000 or more within any given year, must take the following affirmative steps: 1. provide a written statement to all new employees and subcontractors indicating commitment as an equal oppo*unity employer. 2. Actively consider for promotion and advancement available minorities and women. Any contractor, subcontractor, consultant or supplier who willfully disregards the City's nondiscrimination and equal opportunity requirements shall be considered in breach of contract and subject to suspension or termination for all or part of the contract. Contract Compliance Officers will be appointed.by the Directors of Planning, Parks, and public Works Departments to assume the following duties for their respective departments. 1. Ensuring that contractors, subcontractors, consultants, and suppliers subject to these regulations are familiar with the regulations and the City's equal employment opportunity policy. 2. Monitoring to assure adherence to federal, state and local laws, policies and guidelines. 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 MINORIW AND WOMEN CONTRACTORS SUPERSEDES: APril L, L996 APPROVED BY Jlm White, MaYor B March 22,2O2L CITY OF KENT EQUAL EMPLOYMENT OPPORTUNIW COMPLIANCE STATEMENT This form shall be filled out AFTER COMPLETION of this project by the Contractor awarded the contract. I, the undersigned, a duly represented agent of Company, hereby acknowledge and declare that the before- mentioned company was the prime contractor for the contract known as S. 2l2th St. Preservation 72nd Ave. S. to 84th Ave. S. (East Valley Highway)/Federal Aid Number: STPUL-125O(OO9)/Project Number: 19-3003 that was entered into on the between the firm I represent and the City of Kent. I declare that I complied fully with all of the requirements and obligations as outlined in the City of Kent Administrative Policy 1.2 and the Declaration City of Kent Equal Employment Opportunity Policy that was part of the before-mentioned contract. Date By: For Title: 212s St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 9 March 22, 2021 PROPOSAL To the City Clerk City Hall Kent, Washington 98032 The undersigned hereby certifies that IAwc>I >t- /A/ DtasTF teg )Nc - has examined the job site and constru ction details of the work as outlined on the plans and described in the specification s for the project named S. 212th St. Preservation 72nd Ave. S. to 84th Ave.S. (East Valley Highway)/Federal Aid Number: STPUL-125O(OO9)/Project Number: 19-3OO3 for the City of Kent, ,Washington, and has read and thoroughly understands the plans and specifications and contract governing the work embraced in this improvement and the method by which payment will be made for that work and hereby proposes to undertake and complete the work embraced in this improvement in accordance with the bid and contract, and at the following schedule of rates and prices: F NOTE TO BIDDERS: 1) All bid items are described in the Kent Special Provisions (KSP) or the Standard Specifications (WSDOT). Reference the Section No. listed in this proposal, where the bid item is described. 2) Proposal items are numbered in Sequence but are non-continuous. 3) Unit prices for all items, all extensions, and total amount of bid must be shown. 4) Should bid items with identically worded bid item descriptions, marked with asterisk (x), appear in more than one schedule of the proposal, the bidder must bid the same unit price on corresponding items for each schedule. If the Contractor enters different unit prices on these items, the City will unilaterally revise the bid amounts to the lowest unit price on each corresponding item and recalculate the Contractor's total bid amount. The corrected total bid amount will be used by the City for award purposes and fix the amount of the contract bond. EXAMPLE SCHEDULE I - STREET ITEM NO. SECTION NO. UNIT PRICE TOTALAPPROX. OUANTITY ITEM OUNT 1006 2-03.5 WSDOT Roadway Excavation, Including Haul 100 CU YDS $14.00 Per CY $1,400,00 Any bids not filled out properly may be considered non-responsive. 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 10 March 22,2O2l SCHEDULE I . STREET ITEM NO. SECTION NO. UNIT PRICE TOTAL AMOUNT APPROX. QUANTITY ITEM 1000 1-09.7 WSDOT 1 LUMP SUM Mobilization E tlhtur $\'?8,an" Per LS 1010 2-O2.5 KSP 150 SQ YDS $ 'lr5-$ T76b-Remove'Existing Asphalt Concrete Pavement Per SY 10 15 2-02.5 KSP 430 SQ YDS Remove Existing Reinforced Cement Concrete Driveway/Pavement 1", !?- $ [tr,0/o - 1020 2-02.5 KSP 380 SQ YDS Remove Cement Concrete Sidewalk $ 3'J-* lto bo^ Per SY L025 2-02.5 KSP 880 LN FT Remove Cement Concrete Curb and Gutter $ l5-$ t\,10u - PCT LF 1035 2-02.5 KSP 24 LN FT Removal of Traffic Islands and/or Traffic Curb $ 70-$ +w' LFPer 1045 B-21.5 KSP I Removal of Traffic Signs $ UD- $ ?xD- EACH Per EA 1050 2-02.5 KSP 500 LN FT Saw Cut Existing Asphalt Concrete Pavement E n,a€$ tk.2-s- PCT LF 1055 2-02.5 KSP 70 LN FT Saw Cut Existing Cement Concrete Sidewa I k/Gutter $ t1.5D $t?-%t- PCT LF 1060 2-03.5 WSDOT 100 CU YDS Roadway Excavation Incl Haul $ 5b^$ 51D^ 11 Per CY March 22,242L212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SCHEDULE I - STREET ITEM NO. SECTION NO. APPROX. OUANTITY UNIT PRICE TOTAL AMOUNT ITEM 1075 4-03.5 KSP 50 TONS $ 15- Per TON $ 1p-Gravel Borrow, Including Haul and Compaction 1080 4-04,.5 KSP 200 TONS Crushed Surfacing ToP Course, 5/8 Inch Minus $ T€- Per TON ($6.00 Min) $ gtp- 1085 4-04.5 KSP 30 TONS Crushed Surfacing Base Course, I-L/4 Inch Minus *%- $1p-Per TON 1095 5-04.5 KSP 2,LOO TONS HMA Class L/2', PG 58V-22 $ trt^$ l1trrpD-Per TON 1 100 5-04.5 KSP 4,500 TONS HMA Class L/2" for Full Width Overlay, PG 58V-22 $ 8t- Per TON $5Yt,gD' 1105 5-04.5 KSP 1 CALC $35,000x Per CALC $35,000Asphalt Cost Price Adiustment *Common orice to all bidders 1110 5-04.5 KSP 33,000 SQ YDS Planing Bituminous Pavement, 2 Inch Thick # 2'6'J $t2,&-Per SY 1115 5-04.5 KSP 16,000 SQ YDS Additional Planing Bituminous Pavement, 2 Inch Thick E j:?6 $ fLpe) - Per SY 1 120 5-04.5 KSP 1 LUMP SUM Work within UPRR Right of Way s (hffi- E Per LS ftt,ga>- ttz]-5-04.5 KSP 1 LUMP SUM Work within BNSF Right of Way 5 (\e- $ Per LS 4L L2 March 22,202L srD- 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 CHEDULE I - STREET ITEM SE NO. APPROX. OUANTITY UNIT PRICE TOTAL AMOUNT N ITEM NO. tt22 5-04.5 KSP 1 FORCE ACCOUNT BNSF Railroad Flagging $19,000x PCT FA $ lc1,oo - 1125 5-04.5 KSP 200 TONS Hot Plant Mix for Temporary Pavement Patch $ [g)-$ 2j'@* Per TON 1145 8-14.5 KSP 210 SQ YDS Cement Concrete Sidewalk $ +rr Per SY $X4o^ 1150 8-14.5 KSP 25 SQ YDS Cement Concrete Sidewalk, 8 Inch Depth $ Ytr PCT SY $ ?.eo^ tL70 8-14.5 KSP 4 Cement Concrete Sidewalk Ramp Type Parallel A $b'/0'^$ [4'op-EACH Per EA 1180 8-06.5 KSP 430 SQ YDS Cement Concrete Driveway, 8 $ 1€- Inch Depth, Reinforced Per SY $ 7y_p*- ; 1205 8-04.5 KSP 500 LN FT Cement Concrete Curb and Gutter $ y5- Per LF $ lu,a>' 1207 8-04.5 KSP 380 LN FT Cement Concrete Curb and Gutter, 8 Inch Depth, Reinforced $ 2b^$ 1o,v4o -Per LF L2LO 8-04.5 KSP 10 LN FT Precast Concrete Sloped Mountable Curb $ ts^ Per LF $ t*- tztt 8-04.5 KSP 30 LN FT Cement Concrete Extruded Curb, Type 4 $ 3t-$ lop- 13 Per LF March 22,2O2L212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SCHEDULE I - STREET ITEM NO. SECTION NO. APPROX.UNIT PRICE TOTAL AMOUNT ITEM o L220 8-14.5 KSP 350 sQ Fr Detectable Warning Surface $ 15-$2ktw- Per SF L22t 8-14.5 KSP $7., PCT LF $ 4tt>-60 LN FT Detectable Directional Striping t235 8-05.5 KSP 1 Adjust Existing Monitoring Well Lid to Finished Grade $ tll'^ Per EA $ 5D^ EACH t24L 8-20.5 KSP I Non-skid Type 1 Junction Box Frame and Cover $w- $V@- EACH EAPer 1242 8-20.5 KSP 2 Non-skid Type 2 Junction Box Frame and Cover $ [t>.>o- $ Uw- Per EAEACH t243 8-20.5 KSP 3 EACH Non-skid Type 8 Junction Box Frame and Cover $'),,er- PCT EA $ l"m- L245 8-13.5 KSP 13 EACH Install New Riser for Monument's Case and Cover to Finished Grade $)o $ 31o^PCT EA 1250 7-t2.5 KSP 29 EACH Replace Existing Valve Box Top Section and Lid and Adjust to Finished Grade $+E-$ g,\'tF- PCT EA 1315 8-28.5 KSP 10 EACH Pothole Utilities $ Pe a.2^ EA $ totr)-I r 21zth St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 14 March 22,2O2L SCHEDULE I - STREET ITEM SECTION APPROX.ITEM UNIT PRICE TOTAL AMOUNTNO.NO.OUANTITY 1320 8-30.5 KSP 2 Project Sign $1w PCT EA $ lSao ^ EACH 1335 2-07.5 KSP 50 HOURS Watering $la' $1'f@^PET HR 2126 St, Preservation/l-lolcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Schedule I Total 15 March 22,202L sc HEDULE IV - STORM SEWER ITEM NO. SECTION NO. APPROX. OUANTITY UNIT PRICE TOTAL AMOUNT ITEM 4tto 7-O5;5 KSP 5 Adjust Existing Manhole Cover to Finished Grade $ 5uo^ $L@" Per EAEACH 4L20 7-05.5 KSP 7 Replace Existing Rectangular Frame and Cover with Round Frame and Cover E $:o- Per EA $ ,ta@^ EACH 4130 7-05.5 KSP 2 EACH Replace Existing Manhole Lid and Adjust to Finished Grade $ lQ@' PeT EA $t'?,.1:^ Schedule IV Total *1z-- 212t' St. PreservationlHolcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 16 March 22,2O2L SCHEDULE V - TRAFFI CONTROL ITEM NO. APPROX.ITEM UNIT PRICE TOTAL AMOUNTNO. O UANTITY 5005 1-10.s(2) WSDOT 2,704 HOURS Flaggers $ l-o-$ VeL,o)D-Per HR 5015 1-10.s(2) WSDOT 1 LUMP SUM Traffic Control Supervisor $ l&t o@ - $ PCT LS la>ro' 5020 1-10, s(2) WSDOT 1 LUMP SUM Other Temporary Traffic Control $TQaz^$ zerat-Per LS 5025 1-10.5 KSP 350 HOURS Uniformed Off-Duty Police Officer $ La6' $ Per HR ($70.00 Min) 47;7fl2' 5030 1-10.s(2) WSDOT L,924 HOURS Portable Changeable Message $\,flSign Per HR $L1u- 5035 1-10.s(2) WSDOT 3,600 HOURS Sequential Arrow Sign $L^ PCT HR $ 1nt2D - 5080 8-23.5 WSDOT 53,000 LN FT Temporary Pavement Marking - Short Duration $0,16 $ PCT LF I7;tg- 5090 8-09.5 WSDOT 10.1 HUNDRED $M$ PCT HUND 4tu^ ort 4E1s- Raised Pavement Marker Type 2 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 17 March 22,202L SCHEDULE V - TRA FFIC CONTROL ITEM NO. SECTION NO. UNIT PRICE TOTAL AMOUNT APPROX. OUANTITY ITEM 5100 8-22.5 KSP 9,000 LN FT Profiled Plastic Skip Lane Line $ D,5k $ fD+o-PCT LF 5105 8-22.5 KSP L,2OA LN FT Profiled Plastic Double Yellow Center Line $ 2.F $ *Qo- PCT LF 5110 8-22.5 KSP 4,roo LN FT $'L.@ PET LF r14a-Profiled Plastic Two WaY Left Turn Line 5tt2 8-22.5 KSP 7,390 LN FT Profiled Plastic Wide Line $ b'fr $ Per LF 76,ffi' 5113 B-22.5 KSP L,450 LN FT Single Solid Plastic Edge Line $ [,]o Per LF $ ttt9^ 5115 8-22.5 KSP 580 LN FT Plastic Stop Line, 24 Inch Wide 1"$4'uo$ Per LF 5119 8-22.5 KSP L,200 SQ FT Plastic Green Bike Lane 5b- F $lt ,|oo'$1 Per s 5r2A 8-22.5 WSDOT 1,100 SQ FT $5^ Per SF $53p-Plastic Crosswalk Line 5 121 8-22.5 WSDOT 26 EACH Plastic Bicycle Lane SYmbol $ ttb- Per EA $ b1@- 5t22 8-22.5 KSP 3 Plastic Bicycle Detector Pavement Marking $ t50^$ 4p^EACH r8 PCT EA March 22,2OZl212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SCHEDULE V - TRAFFIC CONTROL ITEM NO. SECTION NO. UNIT PRICE TOTAL AMOUNT APPROX. OUANTITY ITEM 5123 8-22.5 WSDOT 24 EACH Plastic HOV Lane Symbol $ lfc.-$ udb-Per EA 5125 8,22.5 WSDOT 20 EACH Plastic Traffic Arrow $ t5O- $ PCT EA lap- 5130 8-22.5 54 WSDOT EACH Plastic Traffic Letter $ 9o- $ PCT EA favo 5L32 8-04.5 KSP 1,100 LN FT Painting Traffic Curb t $ [tw-$ Per LF 5133 8-10.5 KSP I Traffic Pylon $ttrr' $Ioo-PCT EAEACH 5135 8-21.5 KSP 5 EACH Traffic Signs, Including Foundation $ t-fi)^$ 4L9-Per EA 5136 B-21.5 KSP 11 EACH Traffic Signs $ tso- $Tfr^PCT EA 5140 B-22.5 WSDOT 15 EACH Plastic Railroad Crossing Symbol $ 1tu- PCT EA $ ll p&' 5150 8-22.5 KSP 1 LUMP SUM Referencing Existing Pavement Markings $ 1ol6b " $11w-Per LS 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Schedule V Total $ 19 b March 22,202I SCHEDULE VI - ELECTRICAL ITEM NO. SECTION NO. UNIT PRICE TOTALAPPROX. OUANTITY ITEM UNT 6010 8-20.5 KSP 81 EACH 6 Foot Diameter Traffic Loop $ ldo ^ $ PCT EA 8l qF- 6015 8-20.5 KSP 3 EACH Bicycle Detector LooPs $ ?o>-$ )_to^PeT EA 6020 8-20.5 KSP 8 Stub-out to Existing Junction Box $ loo- Per EA $ t@^EACH 6025 8-20.5 KSP 800 LN FT Additional Lead-In Wire $3- $P.Per LF 6030 8-20.5 KSP 1 LUMP SUM Home Run Cable + lor@-$ lo,qr-Per LS 6035 8-20.5 KSP 4 Pedestrian Pushbutton (PPB) Post $ bp-* t%"r-EACH Per EA 6040 B-20.5 KSP 6 EACH Pedestrian Pushbutton (APS) S tW"$ Qoer^PCT EA 6045 8-20.5 KSP 2 EACH $&D PCT EA [uq'-Countdown LED Pedestrian Head (Type D Mount) $ 6050 8-20.5 KSP 8 EACH Countdown LED Pedestrian Head (Type E Mount) +1o- $11rc^PeT EA Schedule VI Total $l"+,1tP ' 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 20 March 22,202L SCHEDULE VII - TEMPORARY EROSION AND SEDIM ENTATION CONTROL ITEM NO. SECTION NO- UNIT PR.ICE TOTAL AMOUNT APPROX. OUANTITY ITEM 7000 8-01.5 KSP 100 SQ YDS Seeding, Fertilizing, and Mulching $ lo' Per SY $t ooo - 7005 8-02.5 KSP 50 CU YDS Topsoil Type A $ (o^$ 1^rtu^Per CY 70L5 8-01.5 KSP 40 Inlet Protection $ 1s'$ '}bo ^ Per EAEACH 7020 8-01.5 KSP 100 SQ YDS Straw Mulch $ t"- Per SY $ lae^ 7025 B-01.5 KSP 100 SQ YDS $7' PCT SY Clear Plastic Covering $b^ 7030 8-01,5 KSP 50 HOURS ESC Lead $ to^ Per HR $abo' 7040 8-01.5 WSDOT 50 HOURS Street Cleaning 3"17r' $ suco- 7050 1-07.1s(1) WSDOT 1 LUMP SUM SPCC Plan $ tteDp - $ PET LS touo- 7055 8-01.5 WSDOT 1 FORCE ACCOUNT Erosion/Water Poll ution Control $20,000x $20,000 Per FA *Common o rice to all bidders 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Schedule VII Total u)' 2t ble March 22,2021 SCHEDULE VIII - PRIVATE UTILITIES - NON.ELIGIBLE ITEM NO. SECTION NO. UNIT PRICE TOTAL AMOUNT APPROX. OUANTITY ITEM 8250 5-04.5 KSP 1 LUMP SUM Grind Around Manhole $ toD- $ Per LS t'go- 8255 7-05.5 KSP 3 Adjust Existing Metro Manhole I [On^ to Finished Grade Per EA $ \oo^EACH Stoo-Sub Total LO.1,o/o WA State Sales Tax Schedule VIII Total 3\}.to$ $v1l7 ,to 212th St. Preservation/Holcomb Federal Aid Numberi SIPUL-1250(009) Project Number: 19-3003 22 l{arch 22,2021 BID SUMMARY \ J41,D5? -Schedule f Schedule IV Schedule V Schedule VI Schedule VIf Schedule VIfI TOTAL BID AMOUNT 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Str€et 1z*" Storm Sewer *ZV'50D ^ Trafflc Control I2-+|too- Eleclrlcal ryn,1a* Temporary Erosion .& Sedimentation Control ffi1\ , to Private Utilities - Non Eligible t ?tvr ,10 23 March 22, ZO21 PROPOSAL SIGNATURE PAGE The undersigned bidder hereby proposes and agrees to start construction work on the Contract, if iwarded to him/her, on or before ten (10) calendar days from the date of the Notice to Proceed, and agrees to complete the Contract within sevenW (7O) working days after issuance of the City's Notice to Proceed. The undersigned bidder hereby agrees to submit all insurance documents, performance bonds and signed contracts within ten (10) calendar days after City awards the Contract. The City anticipates issuance of the Notice to Proceed on the day of the preconstruction meeting. No bidder may withdraw his/her bid for a period of sixty (60) calendar days after the day of bid opening. The required bid security consisting of a bid bond, cashier's check or cash in an amount equal to 5olo of the total amount is hereto attached. Notice of acceptance of this bid or request for additional information shall be addressed to the undersigned at the address stated below. Receipt of Addendum No.'s -, -, -t to the plans and/or speciiications is hereby acknowledged. Failure to acknowledge receipt of the addenda may be considered an irregularity in this proposal. By signing this Proposal Signature Page, the undersigned bidder agrees to accept all contract forms and documents included within the bid packet and to be bound by all terms, requirements and representations listed in the bid documents whether set forth by the City or by the Bidder. Of " h,1o1'l LkItLtt Le_ Nb /ilL.DATE: 212th st, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 E Sig of Authorized RePresentative t.lc'u'tc llfo> /'t^&t^p.nu (Print Name and Title) Address tu C-.Dtl t N urA 1w44- 24 March 22,zOZt BID BOND FORM KNOW ALL MEN BY THESE PRESENTS: That we, and as Surety, are held and firmly bound unto the CITY OF KENT, as Obligee, in the penal sum of Dollars, for the ment of which the Principal and the Surety bond them selves, their rally, byheirs, executors, these presents. inistrators , successors and assigns, jointly and The condition of this o gation is such that if the shall make any award to the Principal for S. 2 St. Preservation Ave. S. to 84th Ave. S. (East Valley Highway) Number: 19-3OO3 I Aid Num STPUL- I 2sO(OO9)/Project According to the terms of the prop or bi ade by the Principal thereof, and the Principal shall duly make and enter into contract w ith the Obligee in accordance with the terms of said proposal or bid a WA and shall give bond for the faithful performance thereof, with Su r Sureties proved by the Obligee; or if the Principal shall, in case of fail so to do, pay a amount of the deposit s in the invitation to null and void;otherw it shall be and remain in full and effect and the Surety shall forthwith pa nd forfeit to the Obligee, as penalty a liquidated damaged, the amount of this nd. SIGNED, SEALED AND DATED THIS DAY OF 202L PRINCIPAL SUREry it to the Obligee the penal then this obligation shall be 20--. Received return of deposit in the sum of 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 25 March 22,202L BID BOND FORM KNOW ALL MEN BY THESE PRESENTS: That we,Lakeside lndustries, lnc.as Principal, and Travelers C""rul , as Surety bound unto the CITY OF KENT, as Obligee, in the penal sum of Dollars, for the payment of which the Principal and the Surety bond themselves, their heirs, executors, administrators, successors and assigns, jointly and severally, by these presents. The condition of this obligation is such that if the Obligee shall make any award to the Principal for S. 2L2rh St. Preservation 72nd Ave. S. to 84th Ave. S. ( East Valley Highway)/ Federa I Aid N umber: STPUL- 1 25O(OO9) / Proiect Number: 19-3OO3 According to the terms of the proposal or bid made by the Principal thereof, and the principal shall duly make and enter into a contract with the Obligee in accordance with the terms of said proposal or bid and award and shall give bond for the faithful performance thereof, with Surety or Sureties approved by the Obligee; or if the principal shall, in case of failure so to do, pay and forfeit to the Obligee the penal amount of the deposit specified in the invitation to bid, then this obligation shall be null and void; otherwise it shall be and remain in full force and effect and the Surety shall forthwith pay and forfeit to the Obligee, as penalty and liquidated damaged, the amount of this bond. SIGNED, SEALED AND DATED THIS 13th DAy OF April 202L. Lakeside lndustries, lnc. PRI Casualty and Surety Company of America SURETY Susan B.Attomey-in-Fact , are held and firmly' Five Percent (5%) of the Total Amount Bid -- HARTFORD CONN. * 20-. Received return of deposit in the sum of $ 2 12th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 25 March 22,2Q2L TRAVELERf Travelers Casualty and Surety Company of America Travelers Casualty and Surety Company St. Paul Fire and Marine Insurance Company POWEROF ATTORNEY KNOW ALL MEN By THESE PRESENTS: That Travelers casualty and surety company of America, Travelers casualty and surety company' and st' paul Fire and Marine tnsurance company are corporations duly brganized dnder the liws of the State of Connecticut (herein collectively called the ,,Companies"), and that the Companies do hereby make, constitute and appoint Susan B. Larson of BELLEVUE Washington , ih"ir trr" and lawful Attorney-in-Fact to sign, execute, seal and acknowledge any and all bonds, recognizances, conditionat undertakings and other writings obtigatory in the nature there;f on behalf of the companies in their business of gudranteeing the fidelity of persons, guarant,eeing the pe-r-formaice of contracts and executing or guaranteeing bonds and undertakings required or permitted in any actions or proceedings allowed by law. lN WITNESS WHEREOF, the Companies have caused this instrument to be signed, and their corporate seals to be hereto affixed, this 17th day of January, 201s. State of Connecticut City of Hartford ss. Companies by himself as a duly authorized officer. lN WITNESS WHEREOF, I hereunto set my hand and official seal My Commission expires the 30th day of June, 2021 By: L.ior Vice President on this the l?th day of January, 2019, before me persondlly appeared Roberl L. Raney, who acknowledged himself to be the Senior Vice President of Travelers Casualty anc su-ied'iompany of Ameriia, Traveiers basualty and Surety Company, and St. Paul Fire and Marine Insurance Company, and that he, as such, being authorized so to do, execuied the foregoing instrument ior the purposes therein contained by signing on behalf of said This power of Attorney is granted under and by the authority of the following resolutions adopted by the Boards of Directors of Travelers casualty and surety company of America, Travelers casualtyand surety iompany, and si Paul Fire and Marine insurance company, which resolutions are now in full force and effect, reading as follows: RESoLVED, that the Chairman, the president, any Vice chairman, any Executive Vice President, any Senior Vice President, any Vice President, any second vice president, the Treasurer, any Assistaht Treasurer, the coiporate secretary or any Assistant secretary may appoint Attorneys-in-Fact and Agents to act for and on behalf of the company and may give such appointee such authority as his or her certificate of authority may prescribe to sign with the company,s name and seal with the company's sla"i uonos, reiognizances, contraots of indemnity, and other writings obligatory in the nature of a bond, recognizance, or "ononlonil undertaking, ano iny ot saic officers oi the Board of Directors at any time may remove any such appointee and revoke the power given him or her; and it is FURTHER RESOLVED, that the Chairman, the President, any vce chairman, any Executive Vice- President, any senior Vice President or any Vice president may delegate itt or "ny part of ifre foregoing authority to one or more officers or employees of this Company, provided that each such delegation is i-n writing and a copy thereof is filed in the office of the Secretary; and it is FURTHER RESOLVED, that any bond, recogniZance, contract of indemnity, or writing obligatory in the nature of a bond, recognizance, or conditional undertaking shall be valid and uinding upon-the company when (a) signei by the Piesident, any Vice chairman, any Executive Vice President, any senior Vice president or any Vice p'resident, any seco;d Vice Fiesident, the Treasurer, any Assistant Treasurer, the corporate secretary or any Assistant secretary ano duly'attesied and sealed with the company's seal by a Secretary or Assistant Secretary; or (b) duly executed (under seal, if required) by one or ror" n=ttt1.nuyoin-Fact and Agents pursuant io the power presoribed in his or her certificate or their certificates of authority or by one or more Cohpany officers pursuant to a written delegation of authority: and it is FURTHER RESOLVED, that the signatUre of each of the following officers: President, any Executive Vice President, any senior Vice President, any Vice president, any Assistaht Vice president, any secretary, any Assisiant secretary, and the ieal of the company may be affixed by facsimile to any Power of Attomey or to any certificate relating thereto appointini Resident Vice Prmidents, Resident Assistant Secretaries or Attorneys-in-Fact for purposes only of "*""utiig and atiesting bonds and lndertaking's and Sther writings obligatory in ihe nature thereol and any such Power of Attorney or certificate bearing such facsimile signature or facsimile seal shall be valid and binding upon thi,company and any such power so executed and certified by such facsimile signature and faJsimile seal shall be valid and binding on the comp-any in the future with respect to any bond or understanding to which it is attached. I, Kevin E. Hughes, the undersigned, Assistant secretary of Travelers casualty and surety company of America, Travelers casualty and surety Company, and St. paul Fire and liarine lnsurance c"mp;"y, do hereby certifo thai the above -and foregoing is a true and conect copy of the Power of Attorney executed by said Companies, which remains in full force and efiect. pa1q6 ltris 13th day of April 2021 Anna P. Nowik, Notary Public { Kevin E. Hughes,Secretary To ,/erify the authenticity of this Power of AtTorney, plase all us at 7'8(m'421-3880. please refer to tfie above-namA enomein-Fact and the detaits of tie bond to which this Power of Attorney is attached' XARlFOfiD, cot{ft. tiat^fil+l; t4JBilC ccilgr t(^r CoNTRACTOR'S QUALTFTCATTON STATEM ENT (RCW 39.O4.35O) THE CITV WILL REVIEW THE CONTRACTOR'S RESPOA'SES TO THIS FORM TO DETERMINE WHETHER THE BIDDING CONTRACTOR I:S RESPONSIBLE TO PERFORM THE CONTRACT WORK. THIS FORM INCLUDES CRTTERIA ESTABLTSHED BY STATE LAW THAT MUST BE MET TO BE CONSIDERED A RESPONSIBLE BTDDER AND QUALTFIED TO BE AWARDED THIS PUBLIC WORKS PROJECT AS WELL AS SUPPLEMENTAL CRTTERIA ESTABLISHED BY THE CITY THAT ARE APPLICABLE TO THIS PUBLIC WORKS PROJECT, THE BIDDER SHO(TLD READ AND RESPAND TO THIS FORM CAREFULLY' Indicia of contractor's responsibility inherently involve subjective determinations as to the contractor's ability to perform and complete the contract work responsibly and to the owner city's satisfaction. The city has an obligation and a duty to its citizens and its taxpayers to administer its budgets and complete its projects in a businesslike manner. Accordingly, it has a duty to exercise the type of inquiry and discretion a business would conduct when selecting a contractor who will be responsible to perform the contract work. 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 26 March 22,2o2L If the bidder fails to request a modification within the time allowed, or fails to appeal a determination that the bidder is not responsible within the time allowed, the city will make its determination of bidder responsibility based on the information submitted. COMPLETE AND S'GAI THTS FORM AS PART OF YO''R BID. FATL'TRE TO PRAPERLY COMPLETE THIS FORM MAY ALSO RESI'LT IN A DETERMTNATION THAT YOUR BID ES AIOAI-RESPONSIVE AND THEREFORE VOID, THIS DOCUMENT HAS IMPORTANT LEGAL CONSEQUENCES: CONSULTATION WITH AN ATTORNEY IS ENCOURAGED WITH RESPECT TO ITS COMPLETION OR MODIFICATION. The undersigned certifies under oath that the information provided herein is true and sufficiently complete so as not to be misleading. IlVztt y<_ /I itL' f,{xt- N te,,rttl- tr608- S 4 q)lN&-Wxt 'q qS){1- SUBMITTED BY NAME: ADDRESS: PRINCIPAL OFFICE: ADDRESS: PHONE: FAX: Lkwsfi>r- tr;\/ ^lLQo Box 1 otk lX1AowA--lf vrn-1&uL1 +Lf,al\,1'la* +'LS ,AIz , "t t2 71> STATUTORY REQUIREMENTS - Per state law a bidder must meet the following responsibil ity criteria 1. Required Responsibility Criteria 1.1 Provide a copy of your Department of Labor and Industries certificate of registration in comptiance with chapter L8-21 RCW. p71Xo$.Arga6f *t 1.2 Provide your current state unified business identifier number. ftlTtr-tf{^cL{r Fl1.3 Provide proof of applicable industrial insurance coverage for your employees working in Washington as required in Title 51 RCW, together with an employment security department number as required in Title 50 RCW, and a state excise tax registration number as required in Title 82 RCW. Providing a copy of a state of Washington "Master License Service Registration and Licenses" form is typically sufficient evidence of the requirements of this subsection. p1T!frot$l1Lv^fr *L 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 27 March 22,2A2L 2 1.4 provide a statement, signed by a person with authority to act and speak for your company, that your company, including any subsidiary companies oi afitiated companies under majority ownership or under control by the owners of the bidder's company, are not and have not been in the past three (3) years, dlsqualified from bidding on any p,ubli^c .^ tL7 works contract under RCW 39.06.010 or 39.12.065 (3). ftTtr/ta{+1&%Fr k' 1.5 Provide a signed statement, signed under penalty of perjury by.a person with authoriiy to act and speak for your company, that within the three- year period immediately preceding the bid solicitation date, your company iS not a "willful" violator as defined in RCW 49.48.082, of any provisions of chapters 49.46,49.48, or 49.52 RCW, as determined by a iinal and binding citation and notice of assessment issued by the Department of [abor and Industries or through a civil judgment entered by a court of limited or generaljurisdiction. ffitatn'Vr,fa- '*1 1.6 Provide proof that a designated person or persons with your company has either received training from the department of labor and industries or an approved training provider on the requirements related to public works and prevailing wages under chapter 39.04 RCW and 39.L2 RCW or provide proof that y-our company has completed three or more public works projects and have had a valid business license in Washington for three or more years and are exempt from this training requirement' r ST.NATURE ftTTrt'+uQN .' t 2.t Dated at this t3 day of Vt-Pruru ,2ozl. Name of Organization:S Title 2.2 C'^er.t Nrc/.e\ -, bei ng duly sworn, deposes and says that the inform-aton piovided herein is true and sufficiently complete so as not to be misleading. Subscribed and sworn before me this I 3 day of A?,\tt- ,2021. Notary Publ My Commission Ex -)da d By 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 28 Marcn 22,ZOZL Department of Labor and Industries PO Box 44450 Olympia, WA 98504-4450 LAKESIDE INDUSTRIES INC Reg: CC LAKESI*274JD UBI: 601-106-847 Registered as provided by Law as: Construction Contractor (CCO 1) - GENERAL 145 LAKESIDE INDUSTRIES INC Effective Date: 4/4/1973 PO BOX 7016 Expiration Date: 7/31/2022 ISSAQUAH WA 980277016 3t312021 LAKESIDE INDUSTRIES INC d-lA. w,o-"nsa"o*mmott / riu6r s tnUusnier lhupgljnlggov). niT,ftrJt tr^t ,-Jt LAKESIDE INDUSTRIES INC Owner or LEE, MICHAEL JAMES Principals LEE, MICHAEL JAMES, PRESIDENT WOOLSTON, DAX EDWARD, TREASURER LEE, SHARON MARIE, CHIEF EXECUTIVE OFFICER LEE, MAUREEN THERESE, CHIEF EXECUTIVE OFFICER OSTERHAUS, MARY PATRICIA, CHIEF EXECUTIVE OFFICER LEE, RHOADY ROBERT, CHIEF EXECUTIVE OFFICER LEE, TIMOTHY GEORGE, CHIEF EXECUTIVE OFFICER DARNELL, LARRY TREASURER (End: 06/17l2008) LEE, JEANNE M, VICE PRESIDENT (End:06122120121 WAGGONER, HENRY R, SECRETARY (End:0710212018) WHITE, JOHN C, AGENT (End:0710212018) LEE,RRSR,PARTNER (End:11127120071 STUTGIS, ROBERT E, PARTNER (End: 1112712007) WA UBI No. 601 106 847 Received by L&l 0611712008 PO BOX 7016 tssAouAH, wA 98027-7016 425-313-2600 KING Gounty Business type Corporation Effective date 07t0112008 Expiration date Untll Canceled License Verifo the contractor's active registration / license / certification (depending on trade) and any past violations' gcnrtry-cllgn 9oilI"49!9-I Active Meets current requirements. License specialties GENERAL License no. LAKEST2T4JD Effective - expiration 0 4 I 0 41 1 97 3- 07 I 31 I 2022 Bond TRAVELERS CAS & SURETY CO Bond account no. {05fi6927 $12,000.00 lnsurance Zurich Amerlcan lns Co Policy no. GLO043012500 $2,000,000.00 https://secure.lni.wa.gov/verify/Detail.aspx?uBl=601106847&LlC=LAKESI*274JD&SAW=113 3t3t2021 LAKESIDE INDUSTRIES INC Received by L&l o512212020 Effective date 06101t2020 Expiration date 06lun021 lnsurance history 9rvln-sr No savlngs accounts durlng the prevlous 6 year perlod. Lawsultc against tho bond or savlnor Nd iaifiiiijlg cgiiiilt iiif 6oriif 6i iifiriga accounrs during rho prevlous 6 ycar pcrtod. L&l Tax dGbts ilii^Ltllii:i dCbte are recorded for thb contractor llcan3e durlng tho provlout 6 ycar pertod, bul romc dobttmry bo rocordod by other egcnclce. Llccnrc Vlolatlon! NitltdiifiC-Vl6Htldns durtng thc prevlour 6 yoar porlod. Certifi cations & Endorsements OMWBE Certlflcatlons Nit adiiid cditifibiiliiiiii iixist for this business. +,PPt?n!199 -r. nlnlrs As-o$ Registerod kaining agent. Check their eligible programs and occupations. Workers'Comp Do you know if the business has employees? ll so, verifi the business is up.to-date on workers' comp premiums. L&l Account lD Sclflnsurcd. 7!.012.?.-7-_4"9. Thls burlness l! certlfled to cover ltl own workerc'comp costs. No prcmlume due. Doing business as LAKESIDE INDUSTRIES INC Estimated workers reported N/A L&l account contact -Email: @lnl.wa,gov Public Works Requirements V€riry the contractor is ellglble to perform work on public works projects. Required Tr.ining- Effoctlve July i, 2019 Ex6mpt from this requirement. Gontractor Strlkes N6;tilkiii-het6 56en lssued agatnst thts contractor. Contractora not allowod to bld Nit Ar65iliriCiiiii iiav'it 6Cdii-E;ued agatnst rhtc conrracror. Workplace Safety & Health Check for any past safety and health violatlons found on jobsites this bu6iness was responsible for. lnspection results date0910912017 Violations lnspection no. 317946123 Location 8705 N6 ll7th Ave Vancouver, WA 98662-3247 lnspection results date 03t't3t2017 lnspection no. 31794021 Location 500 Tennant Way Longvieq WA 98632.2449 No violations https://secure.lni.wa.gov/verify/Detail.aspx?UBl=601106847&Llc=LAKESl.274JD&sAW=2t3 3t312021 LAKESIDE INDUSTRIES INC https://secure.lni.wa.gov/verify/Detail.aspx?uBl=601106847&LlC=LAKESl.274JD&SAW=313 313t2021 LAKESIDE INDUSTRIES INC ffi STAII OrWAI+ll]tGtoN Department of Labor & lndustrles Certificate of Workers' Com pensation Coverage March 3,2021 WA UBI No. L&lAccount lD LegalBusiness Name Doing Business As Workers' Comp Premium Status: 601 106 847 700,227-00 LAKESIDE INDUSTRIES INC LAKESIDE INDUSTRIES lNC Self lnsured. This business is certified to cover its own workers'comp costs. No premiums due. N/AEstimated Workers Reported (See Description Below) Account Representative Licensed Contractor? License No. License Expiration Employer Services Help Line, (360) 9024817 Yes LAKESI-274JD 07t3112022 What does "Estimated Workers Reported" mean? Estimated workers reported represents the number of full time position requiring at least 480 hours of work per calendar quarter. A single 480 hour position may be filled by one person, or several part time workers. lndustrial Insurance lnformation Employers report and pay premiums each quarter based on hours of employee work already performed, and are liable for premiums found later to be due. Industrial insurance accounts have no policy periods, cancellation dates, limitations of coverage or waiver of subrogation (See RCW 5l .1 2.050 and 5r.r6.r90). 'v1 €L C^; Craig N TAKESIDE INDUSTRIES Kent Division 1 8808 SE 256th Street / Covington, WA 98042 ph: 206-343.7375 / lakesideindustries.com Attachment #3 S 2L2th St Preservation Project No. 19-3003 City of Kent Lakeside lndustries Inc., including any subsidiary companies or affiliated companies under majority ownership or under the control by the owners of the bidder's company, are not and have not been in the past 3 years, disqualified from bidding on any public works contract under RCW 39.06.010 or 39.12.065(3). !c Project Manager An equat opportunity employer / wA. sT. coNT. REG. NO. LAKESIDE'274JD / OR. ST. CONT. REG. NO. CCB 1 08542 il TAKESIDE INDUSTRIES Kent Division 18808 SE 2561h Street / Covington, WA 98042 pht 206.343.737 5 / lakesideindustries.com Attachment #4 S 212th St Preservation Project No. L9-3003 City of Kent Within the three year period immediately preceding the bid solicitation date, Lakeside lndustries lnc. has not been a "willful" violator as defined in RCW 49.48.082, of any provisions of chapters 49.46,49.48, or 49.52 RCW, as determined by a final and binding citation and notice of assessment issued by the Department of Labor and lndustries or through a civil judgement entered by a court of limited or general jurisdiction. &t.,gr.4r& Craie tlfdel Project Manager An equat opportunity employor / wA. sT. coNT. REG. NO. LAKESIDE.2T4JD / OR. ST CONT- REG. NO. CCB 1 08542 BIDDER RESPONSIBILITY CRITERIA Statement that Bidder Has Not Been Disqualified This statement is required by state law (RCW 39.04.350(1)(d)) to be submitted to the City before the contract can be awarded. The bidder hereby certifies that, within the three-year period immediately preceding the bid solicitation date (April 13, 2O2L), the bidder has not been disqualified from bidding on any public works contract under Rcw 39.06.010 or 39.12.065(3). Irh^{-u) bL //r\INL" Bidder's Business Name Signatu CtLw,;t6- Authorized Officialx Nle-rla- Printed Name ?go: {4,(/A Title 0 ,V\1,{Vl CAJr Ntrrcn/L0+ Date City State x If a corporation, proposal must be executed in the corporate name by the president or vice-president (or any other corporate officer accompanied by evidence of authority to sign). If a co-partnership, proposal must be executed by a partner. +0,frtdntl*s 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 29 Marcn 22,202L BIDDER RESPONSIBILITY CRITERIA Certification of Compliance with Wage Payment Statutes This certification is required by state taw (RCW 39.04.350(2)) to be submitted to the City before the contract can be awarded. The bidder hereby certifies that, within the three-year period immediately preceding the bid solicitation date (April 13, IOZL), the bidder is not a "willful" violator, as defined in RCW 49.48.082, of any provision of chapters 49.46, 49.48, or 49.52 RCW' as determined by a final and binding citation and notice of assessment issued by the Department of Labor and Industries or through a civil judgment entered by a couft of limited or general jurisdiction. I certify under penalty of perjury under the laws of the State of Washington that the foregoing is true and correct. WWgr DL ,dD tft-. Bidder's Business Name \rli Signatu of Authorized Officialx CRfrr tr t'l lwq,L Printed Name ?b {1^tPR. Title D+ "l\ ,'']+t, t Ul /A,lbn, /rt ur/l Date City State * If a corporation, proposal must be executed in the corparate name by the president or vice-president (or any other corporate officer accompanied by evidence of authority to sign). If a co-partnership, proposal must be executed by a partner. 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 30 March 22,2O2l SUBCONTRACTOR LIST (Contracts over 1 million dollars) HVAC, PLUMBTNG AND ELECTRTCAL tA'rzsf>L tMb /pLName of Bidder: Project Name:s. 212th sr-n 72nd Ave- S- to I Ave. S. fEast Vallev l{ohwav) Federal Aid #:sTPltL-1250() Project Number:I q-?oo" Pursuant to RCW 39.30.060, Bidder shall list the names of the subcontractors with whom the Bidder, if awarded the contract, will subcontract for performance of the work of heating, ventilation, and air conditioning; plumbing; and electrical, or name itself for the work. Failure of the Bidder to submit, within one hour after the published bid submittal time, the names of such subcontractors or to name itself to perform such work or the naming of two or more subcontractors to perform the same work shall render the Bidder's Bid non-responsive and, therefore, void. Heating, Ventilation, and Air Conditioning subcontractor Name , nt/t Plumbing Subcontractor Name N Electrical Subcontractor Name :&+G tN ?. D+,\) .1,o')4 Signatu Bidder 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Date 31 March 22,202t SUBCONTRACTOR LIST (Contracts over 1 million dollars) STRUCTURAL STEEL INSTALLATION AND REBAR INSTALLATION UW)r>L /AI D lMuName of Bidder: Project Name:s- 212th - Preservation 7 Awe- S- to 84th s_ fEast lev Hio Federal Aid #;STPUL-r250foo9) Project Number:19-3 pursuant to RCW 39.30.060, Bidder shall list the names of the subcontractors with whom the Bidder, if awarded the contract, will subcontract for performance of the work of structural steel installation and rebar installation. Failure of the Bidder to submit, within 48 hourS after the prblitn.O bid submittal time, the names of such subcontractors or to name itself to perform such work or the naming of two or more subcontractors to peform the same work shall render the Bidder's Bid non-responsive and, therefore, void. Structural Steel Installation Subcontractor Name:+ Rebar Installation Subcontractor Name:-\ +L C-c>n., r" h D+ "l) ,+ozl Signat Bidder 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Date 32 March 22,2021 Local Agency Name -ocal Agency Address 220 4th Ave. S. (ent, WA 98032 Local Agency Subcontractor List Prepared in compliance with RCW 39.30.06A as amended To Be Submitted with the Bid Proposat Project Name S ?ltfh sr tion *1)nd Arre S tn R4+h ve S fEasf Vnllev ftriohrvcw\ Failure to list subcontractors with whom the bidder, if awarded the contract, will directly subcontract for performance of the work of structural steel installation, rebar installation, heating, ventilation and air conditioning, plumbing, as described in Chapter 18.106 RCW and electrical, as described in Chapter 19.28 RCW or naming more than one subcontractor to perform the same work will result in your bid being non-responsive and therefore void. Subcontractor(s) with whom the bidder will directly subcontract that are proposed to perform the work of structural steel installation, rebar installation, heating, ventilation and air conditioning, plumbing, as described in Chapter 18.106 RCW, and electrical as described in Chapter 19.28 RCW must be listed below. The work to be performed is to be listed below the subcontractor(s) name. To the extent the Project includes one or more categories of work referenced in RGW 39.30.060, and no subcontractor is listed below to perform such work, the bidder certifies that the work will either (i) be performed by the bidder itself, or (ii) be performed by a lower tier subcontractor who will not contract directly with the bidder.UrG /nt LSubcontractor Name Work to be performed z|-LC-\R"L ckL Subcontractor Name Work to be performed Subcontractor Name Work to be performed Subcontractor Name Work to be performed Subcontractor Name Work to be performed * Bidde/s are notified that it is the opinion of the enforcement agency that PVC or metal conduit, junction boxes, etc, are considered electrical equipment and therefore considered part of electrical work, even if the installation is for future use and no wiring or electrical current is connected during the project. DOT Form 271-015A Revised 0612A20 33 CITY OF KENT COMBINED DECLARATION FORM: NON-COLLUSTON, MTNTMUM WAGE NON.CO LLU SION DECLARATION I, by signing the proposal, hereby declare, under penalty of periury under the laws ofthe United States that the following statements are true and correct! 2. That the undersigned person(s), firm, association or corporation has (have) not, either directly or indirectly, entered into any agreement' participated in any collusion, or otherwise taken any action in iestraint of free competitive bidding in connection with the project for which this proposal is submitted. That by signing the signature page of this proposal, I am deemed to have signea and to have agreed to the provisions of this declaration. AND MINIMUM WAGE AFFIDAVIT FORM I, the undersigned, having duly sworn, deposed, say and ceftify that in connection with the performance of the work of this project, I will pay each classification of laborer, workman, or mechanic employed in the performance of such work not less than the prevailing rate of wage or not less than the minimum rate of wage as specified in the principal contract; that I have read the above and foregoing statement and certificate, know the contents thereof and the substance as set forth therein is true to my knowledge and belief. S. 2l2th St, Preservation 72nd Ave. S, to 84th Ave. S. (East Valley Highway) Federal Aid Number; STPUL-l25O(OO9) Project Number: 19-3003 NAME OF PROJECT l,k{-L5$L //VD /NC, 1 SIG 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 NAME OF BIDDER'S FIRM OF AUTHORIZED REPRESENTATIVE OF BIDDER w 34 March ZZ,2O2L Failure to return this Declaration as part of the bid proposal package will make the bid nonresponsive and ineligibte for award. NON.COLLUSION DECLARATION I, by signing the proposal, hereby declare, under penalty of perjury under the laws of the United States that the following statements are true and correct: 1 That the undersigned person(s), firm, association or corporation has (have) not, either directly or indirectly; entered into any agreement, participated in any collusion, or otherurise taken any action in restraint of free competitive bidding in connection with the project for which this proposal is submitted. That by signing the signature page of this proposal, I am deemed to have signed and to have agreed to the provisions of this declaration. 2. NOTICE TO ALL BIDDERS To report rigging activities call 1-800424-9A71 The U.S. Department of Transportation (USDOT) operates the above toll-free "hotline" Monday through Friday, 8:00 a.m. to 5:00 p.m., eastern time. Anyone with knowledge of possible bid rigging, bidder collusion, or other fraudulent activities should use the "hotline" to report such activities. The "hotline" is part of USDOT's continuing effort to identify and investigate highway construction contract fraud and abuse and is operated under the direction of the USDOT lnspector General. All information will be treated confidentially and caller anonymity will be respected. DOT Form 272-036lEF 07t2011 SR 35 Local Agency Certification for Federal-Aid Gontracts The prospective participant certifies by signing and submittjng tnis bid or proposal, to the best of his or her knowledge and belief, that: (1) No Federal appropriated funds have been paid or will be paid, by or on behalf of the undersigned, to any person for influencing or attempting to influence an officer or employee of any Federal agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with the awarding of any Federal contract, the making of any Federal grant, the making of any Federal loan, the entering into of any cooperative agreement, and the extension, continuation, renewal, amendment, or modification of any Federal contract, grant, loan or cooperative agreement. (2) lf any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any Federal agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with this Federal contract, grant, loan, or cooperative agreement, the undersigned shall complete and submit Standard Form-LLL, "Disclosure Form to Report Lobbying," in accordance with its instructions. This certification is material representation of the fact upon which reliance was placed when this transaction was made or entered into. Submission of this certification is a prerequisite for making or entering into this transaction imposed by Section 1352,Title 31, U.S. Code. Any person who fails to file the required certification shall be subject to a civll penalty of not less than $10,000 and not more than $100,000 for each failure. The prospective participant also agrees by submitting his or her bid or ProPosal that he or she shall require that the language of this certification be included in all lower tier subcontracts. which exceed $100,000 and that all such subrecipients shall certifu and disclose accordingly. 272-040AeF 11 SR 36 DOT Form 07120 -.W ffiI[#nffi**ilarion Disa_dvantqrged Busi ness Enterpfise (DBE) Bid ltem Breakdown Form 1. Contract Number STPUL-1250(009) 2. Contract Name S. 212th St. Preservation -72nd Ave. S. to 84th Ave. S. (East Valley Highway) 3. Prime Contractor 4. Prime Contractor Representative Name 5. Prime Contractor Representative Phone Number 6. Prime Contractor Representative Email Column 1 Name of UDBE (See lnstructions) Column 2 Bid ltem # (S€e lnslruotions) Column 3 FulUPartial (Soe lnstruclions) Column 4 Quantity (See lnstlctions) Column 5 Description (Ses lnstructons) Cdumn 6 Unit Price (See lnslruotioN) Cdumn 7 Total Unit Cost (SeB lnsirudions) Column 8 Dollar Amount to be Applied Towards Goal (See lNtructions) Subtotal:$ 0.00 $ 0.00 Name of UDBE Bid ltem #FulllPartial Quantity Description Unit Price Total Unit Cost Dollar Amount to be Applied Towards Goal Subtotal:$ 0.00 $ 0.00 Name of UDBE Bid ltem #FulUPartial Quantity Description Unit Price Total Unit Cost Dollar Amount to be Applied Towards Goal Subtotal:$ 0.00 $ 0.00 Name of UDBE Bid ltem #Full/Partial Quantity Description Unit Price Total Unit Cost DollarAmount to be Applied Towards Goal Subtotal $ 0.00 $ 0.00 TOTAL UDBE Dollar Amount $ 0.00 $ 0.00 DOT Form 272-054 Revised Ogl2020 37 ^-. WH$lllfl'"1L?',1!?,''oorra*on Disadvantaged Business Enterprise (DBE) Bid ltem Breakdown Form 1. Contract Number STPUL 1250-(009) 2. Contract Name S. 212th St PreservationT2nd Ave S to 84th Ave S. (E Valley Highway) 3. Prime Contractor Lakeside lndustries 4. Prime Contractor Representative Name c Nickel 5. Prime Contractor Representative Phone Number 253-631-361'1 6. Prime Contractor Representative Email Craig. nickel@lakesideindustries.com Column 1 Name of UDBE (See lnstructions) Column 2 Bid ltem # (See lnstructions) Column 3 Full/Partial (See lnstructions) Column 4 Quantity (See lnstructions) Column 5 Descrlption (See lnstrucuons) Column 6 Unit Prlce (See lnstuctions) Column 7 Total Unit Cost (See lnstructions) Column 8 DollarAmount to be Applied Towards Goal (See lnsrudions) G&Glnc.1241 Complete 8EA Electrical $ 800.00 $ 6,400.00 $ 6,400.00 G&Glnc.1242 Complete 2EA Electrical $ 1,000.00 $ 2,000.00 $ 2,000.00 G&Glnc.1243 Complete 3EA Electrical $ 2,000.00 $ 6,000.00 $ 6,000.00 G&Glnc.6010 Complete 81 EA Electrical $ 1,000.00 $ 81,000.00 $ 81,000.00 Subtotal:$ 95,400.00 $ 95,400.00 Name of UDBE Bid ltem #FulUPartial Quantity Descrlption Unlt Price Total Unit Cost DollarAmount to be Applied Towards Goal G&Glnc.6015 Complete 3EA Electrical $ 700.00 $ 2,100.00 $ 2,100.00 G&Glnc.6020 Complete 8EA Electrical $ 100,00 $ 800.00 $ 800.00 G&Glnc.6025 Complete 8OO LF Electrical $ 5.00 $ 4,000.00 $ 4,000.00 G&Glnc.6030 Complete 1LS Electrical $ 10,000.00 $ 10,000.00 $ 10,000.00 Subtotal:$ 16,900.00 $ 16,900.00 Name of UDBE Bid ltem #FulUPartial Quantity Description lJnit Price Total Unit Cost DollarAmount to be Applied Towards Goal G&Glnc.6035 Complete 4EA Electrical $ 3,000.00 $ 12,000.00 $ 12,000.00 G&Glnc.6040 Complete 6EA Electrical $ 1,000.00 $ 6,000.00 $ 6,000.00 G&Glnc.6045 Complete 2EA Electrical $ 800.00 $ 1,600.00 $ 1,600.00 G&Glnc.6050 Complete 8EA Electrical $ 900.00 $ 7,200.00 $ 7,200.00 Subtotal:$ 26,800.00 $ 26,800.00 Name of UDBE Bid ltem #Full/Partial Quantity Description Unit Price Total Unit Cost DollarAmount to be Applied Torrards Goal Obunco Engineering 51 50 Complete 1LS Su rvey-Referen ce/Layoul $ 7,950.00 $ 7,950.00 $ 7,950.00 Reece Construction 1110 Partial 33,000 sY ACP Milling/Planing $ 1.00 $ 33,000.00 $ 33,000.00 Reece Construction 1115 Partial 16,000 sY ACP Milling/Planing $ 1.44 $ 23,040.00 $ 23,000.00 Subtotal:$ 63,990.00 $ 63,950.00 TOTAL UDBE Dollar Amount:$ 203,090.0($ 203,050.00 DOT Form 272-054 Revised 0912020 ^-.w H$lll,lt"lL ?t"ii"n "oorration Disadvantaged Business Enterprise (DBE) Bi-d ltem Breakdown Form 1. Contract Number srPUL 1250-(009) 2. Contract Name S. 212th St PreservationT2nd Ave S to 84th Ave S. (E Valley Highway) 3. Prime Contractor Lakeside lndustries 4. Prime Contractor Representative Name Craig Nickel 5. Prime Contractor Representative Phone Number 253-631-361 1 6. Prime Contractor Representative Email Craig. nickel@lakesidei ndustries. com Column 1 Name of UDBE (See lnstructions) Column 2 Bid ltem # (See lnsrudjons) Column 3 Full/Partial (See lnstructons) Column 4 Quantity (See lnstructions) Column 5 Description (See lnsrudions) Column 6 Unit Price (See lnstructions) Column 7 Total Unit Cost (See Instructions) Column 8 Dollar Amount to be Applied Towards Goal (See lnstructions) J&G Conc. Corp 1000 Partial 1LS Mobilization $ 2,500.00 $ 2,500.00 $ 2,500.00 J&G Conc. Corp 1120 Partial 1LS Concrete Paving $ 13,000.00 $ 13,000.00 $ 13,000.00 J&G Conc. Corp 1121 Partial 1LS Concrete Paving $ 13,000.00 $ 13,000.00 $ 13,000.00 J&G Conc. Corp 1145 Complete 210 SY Concrete Paving $ 40.00 $ 8,400.00 $ 8,400.00 Subtotal $ 36,900.00 $ 36,900.00 Name of UDBE Bid ltem #Full/Partial Quantity Description Unit Price Total Unit Cost DollarAmount to beApplied Towards Goal J&G Conc. Corp 1 150 Complete 25 SY Concrete Paving $ 80.00 $ 2,000.00 $ 2,000.00 J&G Conc. Corp 1170 Complete 4EA Concrete Paving $ 3,500.00 $ 14,000.00 $ 14,000.00 J&G Conc. Corp 1'180 Complete 430 SY Concrete Paving $ 75.00 $ 32,250.00 $ 32,250.00 J&G Conc. Corp 1205 Complete 5OO LF Concrete Paving $ 25.00 $ 12,500.00 $ 12,500.00 Subtotal:$ 60,750.00 $ 60,750.00 Name of UDBE Bid ltem #Full/Partial Quantity Description Unit Price Total Unit Cost DollarAmount to be Applied Towards Goal J&G Conc. Corp 1207 Complete 380 LF Concrete Paving $ 28.00 $ 10,640.00 $ 10,640.00 J&G Conc. Corp 1220 Complete 350 SF Concrete Paving $ 75.00 $ 26,250.00 $ 26,250.00 Subtotal:$ 36,890.00 $ 36,890.00 Name o' UDBE Bid ltem #Full/Partial Quantity Description Unit Price Total Unit Cost DollarAmount to be Applied Towards Goal Subtotal:$ 0.00 $ o.oo TOTAL UDBE Dollar Amount:$ 134,540.0($ 134,540.00 DOT Form 272-054 Revised 0912020 tnstructions for Disadvantaged Business Enterprise (DBE) Bid ltem Breakdown Form Box 1: Provide the Contract Number as stated in the project information webpage. Box 2: Provide the Name of the project as stated in the project information webpage. Box 3: Provide the Name of the bidder (Proposal holder) submitting Bid. Box 4: provide the name of the prime contractor's representrative available to contact regarding this form. Box 5: provide the phone number of the prime contractor's representative available to contact regarding this form. Box 6: provide the email of the prime contractor's representative available to contact regarding this form' Column 1: provide the Name of the Disadvantaged Business Enterprise (DBE) Firm. DBE Firms can be found using the search tools under the Firm Certilication section of the Diversity Management and Compliance System (DMCS) webpage https:/lwsdot.diversitycompliance.com. Column 2: provide the Bid ltem Number (as it appears in the engineer's estimate bid check report) available on the project information webpage. Column 3: lf the DBE is performing only part of the bid item, mark "Partial'. lf the DBE is performing the entire bid item' mark "Complete". Column 4: provide the estimated quantity for the specific bid item. For trucking firms, use hour or another unit of measure' Column 5: Provide a description of the work to be performed Uy tne Oee. Column 6: provide the price per: unit and specifi the type of unit used. For trucking firms,:use hour or another unit of measure. ': Column 7: Provide the estimated total unit cost amount per bid item- Golumn 8: provide the'amount of the bid item being used to fulfil the DBE ggal; Ilt" ygrf to be performed must be consistent with the Certified Business Descripti6n of the DBE provided in the DMCS webpage https://wsdot. diversitycompliance.com. Mobilization up to 10% is acceptable. lf mobilization is more than 100/o additional information andior justification may be requested. The total amount shown for each DBE shall match the amount shown on the DBE Utilization Certifi cation Form. Use Additional Sheets if necessary. DOT Form 272-054 Revised Ogl2020 38 Disadvantaged Business Enterprise Uti I ization Certification To_be eligible for Award of this Contract the Bidder shall fill out and submit, as a supplement to its sealed Bid proposal, a Disadvantaged Business Entelpriqe (DBE) Utilization Certification. The Contractihg Agency shall consider as nbn- responsive and shall reject any Bid Proposal that does not contain a DBE Utilization-CertiRcition which properly demonstrates that the Bidder will meet the DBE participation requirements in one of the manners provid'ed ior ifi tneproposed Contract. Refer to the instructions on Page 2 when filling out this form or the Bid iray be rejected. Anexample form has been provided on Page 3. The successful Biddei's DBE Utilization Certification shall b-e deemed apart of the resulting Contract. Wmlringtm $tate Department of Tiansportction Box 1 assure Box 2: subcontracts ?fl.tu Stbt- ^/b c certifies that the DBE firms listed below have been contacted on Contract, additional it shall or supply agreements are sheets.)+?DT P te AtAV t\:i-toN - c-,1Y1 at W^Jr n'W% Name of DBE (See instructions) Column 1 Project Role (See instructions) Column 2 Description of Work tsee instructions) Column 3 Column 4 DollarAmount Subcontracted to DBE (See instructions) Dollar Amount to be Applied Towards Goal (See instructions) Column 5 Q+a ,uc SobLoNTt*tta.Et-ecrztceL $ rcl, to0'c">$ lgt, t oo.e 5+8 c'"t#/o Sosco*rf'llacttf'CopcAarg fAvrrvh /fl*76,ou 4 n't.lro.oe $ Bq.irc,e OBgNc'o EN6N6gLtpat 6$$ cot'T lztrcttp.9og.V 6'l t tt Q 4 J,qso:t $ 7, ?so e' KsecE 6a1v6l'tsutoo ae,S.tgwg*cro'.AL? YtuuuS /?tt*ttp6 ttf. fAt)alt I se oqo.*h 56,orn.9 Disadvantaged Business Enterprise $ E34,7r?.Total DBE Commitment DollarAmount Condition of Award Contract eoal 6of Box 3 Box 4 I E^S^V..1"cking. Box 5 the Bidder is stating that their attempts to solicit sufficient DBE participation to meet the COA Contract goal has been unsuccessful and good faith effort will be submitted in accoriance with Section 1-02.9 of the Contract DOT Form 272-056 Revised 03/2018 39 L lnstructions for Disadvantaged Business Enterprise Utilization Certification Form Box 1: Name of Bidder (Proposal holder) submifting Bid. Box 2: Name of the Project. Column 1: Name of the Disadvantaged Business Enterprise (DBE). DBE firms can be found using thg Divers.ity ManagemenGnA Compiiance System web bage:'https://wsdot.dive Repeat the name of the DBE for each Project Role that will be performed. Column 2: The Project Role that the DBE will be performing as follows; . Prime Contractor. Subcontractor. Subcontractor (Force Account). Work sublet as Force Account must be listed separately. . Manufacturer. Regular Dealer. Work sublet to a Regular Dealer must be listed separately. . Regular Dealer status must be approved prior to Bid submittal by the Office of Equal Opportunity, Wa-shington State Department of iransportation, on each Contract. . Broker. Work sublet to a Broker must be listed separately. List each project role to be performed by a single DBE ind.ividually on.a separate row. The role is used to determine wtiit bortion ot1fie amount to be subcontracted (Colurin ) mai be applied toward meeting the goal (column 5). Column 3: provide a description of work to be performe! by thq DBE. lhg yvork !o -b,e performed must be consistent with- ine CertineObudiness Description cit tne Oef. piovided at the Diversity Management and Compliance System web page htlps ://wsdot. d ivelsiiycompliance. com . A Bidder subletting a portion of a bid item shall state "Partial" and describe the Work that is included. . For example; "Electrical (Partial) - Trenching'- . "Mobilization" will not be accepted as a description of Work. Column 4: List the total amount to be subcontracted to each DBE for each Project Role they are performing. Column 5: This is the dollar amount for each line listed in the certification that the prime intends to_apply towards meeting- tnebOn Coniricigoai lt may be that only a portion of the amount subbontracted to a DBE in Column 4 is etioibte to Oe.drdciiieO towarO'meetino the goal See Note 1, Note 2, Note 3. The Contracting Agency wjll utilize the-sum of this column (Box 4) to def-erminb whether or not the bidder has met the goal. ln the event ot.an arithmetic error in summing ccitumn 5 or an error in making appropriate reductions in the amounts in column iour, See f,fote t,'ttote i, frote 3, then the mathematics \till b'e cbrrected and the total (Box 4) will be revised accordingly. N ote 1 Note 2: For Work sublet to a Regular Dealer the bidder may only claim 60% of the cost of t!e-rytale^rials or supplies ifof umn +l towaiOs medting the goal (Column 5). -For elample;. M.aterial cost = $100,000 (Column 4) equates io ($100,000 X 60%) = $60;000 (eolumn 5) to be applied towards the goal N ote 3:For Work sublet to a B roker the bidder may amount sub only claim the fees paid to Broker towards meeting the to ($100,000goal(Col umn 4 For example;let to a broker $t 00,000 (Col umn 4 )equates X reasonable fee 5 to be the Box 3: Box 4 Box 5 DOT Form 272-056 Revlsed 10120'19 Box 4 is the sum of the values in column 5. This value must equal or exceed the COA Contract goal amount written in Box 3 or; Check Box 5 if insufiicient DBE Participation has been achieved and C 9999 faith^effort is. required. Refer to the subsection titled, Se/ecfibn of Succesiful Bidder/Good Faith Efforts (GFE) in the Contract. See the Disadvantaged Business Enterprise Participation specification in the Contract for more information. 40 Disadvantaged Business Enterprise Utilization Certification To_be eJigible forAward of this Contract the Bidder shall fill out and submit, as a supplement to its sealed Bid Proposal, a Disadvantaged Business Enterprise (DBE) Utilization Gertification. The Contractin! Agency shall consider as nbn- responsive and shall reject any Bid Proposalthat does not contain a DBE Utilization Certification which properly demonstrates that the Bidder will meet the DBE participation requirements in one of the manners provid'ed for ih the proposed Contract. Refer to the instructions on Page 2 when filling out this form or the Bid may be reiected. An example form has been provided on Page 3. The successful Bidder's DBE Utilization Certification shall b-e deemed a part of the resulting Contract. Box 1:certifies that the DBE firms listed below have been contacted on p assure subcontracts or agreements are Box2 IIS 395 Snokane Citv T.to Stevens Countv Line - Pavins and Safetv Gontract, it shall additional sheets.) Column 1 Name of DBE (See instructions) Column 2 Project Role (See inslructions) Column 3 Description of Work (See instructions) Column 4 DollarAmount Subcontracted to DBE (See instructions) Column 5 DollarAmount to be Applied Towards Goal (See instructions) A PIus Construction Cornpany Prime Asphalt and concrete paving, aqphalt milling, preleveling and pavement repair N/A 900,000 In the Line Services, Inc.Subcontractor (Force Account) Crack sealing 20,000 10"000 In the Line Sewices, Inc.Subcontractor Guideposts, joint seal, pavement darkers, tempotary signage, construclion sign installation 200,000 200,000 The Everything Guys, LLC Regular Dealer Rental and sales ofhighway construction and related equipment and materials 100,000 60,000 Optimus Prime l-ruckitg, Inc, Subeontractor Dump'Irucking 50,000 50,000 Metalheads, Inc.Manufactrer Dorvel Bats 75,000 75,000 Erosion Undcr Control Co. Broker Erosion control blankets, straw bales and wattles, sand bags 15,000 250 -A _^{\.4 I{. ltv L 1lrt -1fjV)' Disad.vantaged Business Enterprise 356.968.16 TotalDBE Commitment Do[arAmount 1.295-250 Condition of Award Contract Goal Box 3 Box4 f flB-y clecking Box 5 the Bidder is stating that their attempts to solicit sufficient DBE participation to meetthc-COA Contract ooal has been unsucces5ful and good faith effort will be submitted in'accordance withSection 1-02.9 of tHe Contracl DOT Form 272-056 Revised 0212018 41 -W ffiHiffiffirrseorta*m Disadvantaged Business Enterprise (DBE)Trucking Credit Form PARTA: TO BE COMPLETED BYTHE BIDDER This form is in support of the trucking commitment identified on the DBE Utilization Certification Form submitted with the proposal Please note that DBE's must be certified prior lo time of submittal. Use additional sheets as neoessary. PART B: TO BE COMPLETED BYTHE DBE TRUCKING FIRM Note: DBE trucking firm participation may only be credited as DBE participation for the value of the hauling services, not for the materials being hauled unless the trucking firm is also recognized as a supplier of the materials used on the project and approved for this project as a regular dealer. 1. Type of Material expected to be hauled? 2. Number of fully operational trucks expected to be used on this Project? 3. Number of trucks and trailers owned by the DBE that will be used on this project? 4. Number of trucks and trailers leased by the DBE that will be used on this Dump trucks: Dump irucks: Dump trucks: DOT Form 272-058 Revised 0912020 Tractor/trailers: Tractor/trailers: Tractor/trailers: FederalAid # sTPUL-1250(009) Contract #Project Name S. 2121h St. Preservation lf listing items by hours, or bY lumP sum amounts, please provide calculations to substaniiate the quantities listed Bid ltem Item Description Bidder Name/Title (please print) Phone Fax Signature I certify that the above information is complete and accurate. Address Email Date - DBE Firm Name Name/Title (please print) Certiflcation Number Phone Fax Signature I that the above information is and accurate. Address Email Date 42 Submit this form to in accordance with section 1-02.9 of the Contract. lnstruction to Bidder: The Bidder shall complete and submit the Disadvantaged Business Enterprise (DBE) Trucking Credit Form in accordance with Section 1-02.9 of the Contract. INSTRUCTIONS Please note -All Fields are required PARTA: TO BE COMPLETED BYTHE BIDDER FederalAid: lnclude the project federal-aid number. County: Specify the County where the project will take place. Contract #: Specifo the Project Contract Number which can be found in the Engineer's estimate bid check report. Bid ltem: Provide the Bid ltem Number (as it appears in the engineer's estimate bid check report) for which trucking services will be utilized. Item Description: Provide description of the bid item (as it appears in the engineer's estimate bid check report) for which trucking will be utilized. Bidder: ln this section, provide the bidder's legal name, title, Business address, Phone and email. The bidder's representative signature is required in addition to the date the form was signed. PART B: TO BE COMPLETED BYTHE DBE TRUCKTNG FIRM Question 1: Specifo type of material that will be hauled (i.e. Sand, HMA, gravel) Question 2: Specify the toial number of operational trucks that will be used on the project. Question 3: Specify the total number of operational trucks and trailers owned by the DBE that will be used on the project. Question 4: Specify the total number of operational trucks and trailers leased by the DBE that will be used on the project. DBE Firm: ln this section, provide the DBE Firm's legal name, DBE Firm's representative legal name and tifle, certification Number (Found in the firm's OMWBE Profile page in the OMWBE directory), Business address, Phone, fax and email. The DBE Firm's representative signature is required in addition to the date the form was signed. DOT Form 272-058 Revised Ogl2O2O 43 ^-. F _r!r.la Disadvantaged Busines s Enterprise (DBE) W H5illlfl,Hit?FHn"po*u* fvritten conrirmatioi Document see contract Provisions: DBE Document submittal Requiremenls Disadvantoged Busines s Enterpris e Participalion THIS FORM SHALL ONLY BE SUBMITTED TO A DBE THAT IS LISTED ON THE CONTRACTOR'S DISADVANTAGED BUSINESS ENTERPRISE UTILIZATION CERTIFICATION. THE CONTRACTOR SHALL COMPLETE PART A PRIOR TO SENDING TO THE DBE. PARTA: To be completed hy the bidder The enffies below shall be consistent with what is shown on the Bidder's Disadvantaged Business Enterprise utilization certification. Failure to do so will result in Bid rejection. Contract Title:s.212th St.Preservation -72nd Ave. S. to 84th Ave.S. (East Vallev Bidder's Business Name: Description of DBE's Wbrk: DBE's Business Name DollarAmount to beApplied Towards DBE Goal DollarAmount to be Subcontracted to DBE* *Optional Field PART B: To be completed by the Disadvantaged Business Enterprise As an authorized representative of the Disadvantaged Business Enterprise, I confirm that we have been contacted by the niider with regard to the referenced project for the purpose of performing the Work described above. If the Bidder is awarded the Contract, we will enter into an agreement with the Bidder to participate in the project consistent with the information provided in Part A of this form. Name (printed) Signature: Title: Address: DOTForm 422-031 Revised 07t2O16 Date: 44 Washington State Department of Transportation D isadvantaged Business Enterprise (DB E) Written Confirmation Docu ment See.Contract Provisions: DBE Document Submittal Requirements Disadtant aged Business Enlerprise Parlicipalion THIS I.-ORM SHALL ONLY BE SUBMITTED TO A DBE THAT IS LISTED ON THE CONTRACTOR'S DISADVANTAGED BUSINESS ENTERPzu SE UTI LIZATION CERTIFICATI ON. 'fHE CONTRACTOR SHALL COMPLETE PAKI'A PRIOR TO SENDING'fO THE DBE. PART A: To be completed by the bidder The entries belorv shall be consistent with what is shown on the Bidder's Disadvantaged Business Enterprise Utilization Certification. Failure to do so will result in Bid rejection' Contract Title:s.212th sr.on -72nd Ave. S. to 84th Ave. S. (East V allev Hishwav) Bidder's Business Name r-r$pc DBE's Business Name (A 5\]( Description of DBE's Work: DollarAmount to be Applied lbwards DBE Goal:oo P" DollarAmount to be Subcontracted to DBE*:.Optional Field l4,BT B: To be completed by the Disadvantagcd Busincss Enterprise As an authorized representative of the Disadvantaged Business Entelprise, I confirm that we have been contacted by the Bidder with regard to the referenced project for the purpose of performing the Work described above. If the Bidder is awarded the Contract, we will enter inlo an agreement with the Bidder to participate in the project consistent with the infbrmation provided in Part A of this form. Name (printed)Y-Y-\-- l- Sigrrature: Iitle: Address: DOTForm 422-031 Revised 0712016 _%i)\Date:A't.e <_lKr(-*c\ti '7 44 -\ rrr--L:-rr-,a..6ra Disadvantaged Business Enterprise (DBE) W H$lll#:ft#*L"r*rtarion fvritten conrirmation Document See ()ontract Provisiotts: DBE Docuntent Subtrrittal Requiteilleilts D i s a dt'c:nta ge d Bus i n e s s E n terpr is e P a r tic ipati on TI{IS FORM SI{ALL ONLY BE SUBMITTED TO A DBE TIIAT IS LISTED ON TFIE C]ONTRACTOR'S i] I S A DVANTAGED B U S INES S bN'f ERPRI SE UTILIZATION CERTTFI CATION' THECONTRACTORSHALLCOMI,LETEPARfAPRIORToSENDINGToTHEDBE. I'ART Ai- lb hc completed by the bidder The entries below shall be consistent.i,riith what is shown on the Bidder's Disadvantaged Business Flnterptjse tJtilization Certification. Failure to do so will result irr Bid rejection' (lontract Title ,LA KESIDT' INDUSTRIES HS Bidder's Busittess Name J&G CONCTTETE CORPDBE's Busiuess Name: Dcscription of DBE,'s Work: llylli 'f CONCRETE FLAT WORK l)ollar Anrount to be Applied Towards DBE Goal:$ 134,540.00 Dollar Amount to be Subcoutracted to I)BE* *OPtional Field . Namc (printed)JORGE VELICA I JSLG CONCRETE CORP Signaturc: As a, a'thorizecl representative of the Disadvantaged Business Enletprise, I confirm thal we have beeu co'tacted by the Bidder with regard to the ref-erenJed proiect for the put1,o*. of performing the work described above. If the Bicld*, ", o*ur.r"ain" conrract, we will enter into an agr€ement with the Biddel to participate in the project consistent with the informaiiolr provided in Part A of this forrn. Title: Address DOTForm 422-031 Revised 0712016 PO BOX 1062 MILTON" wA 98354 Date: 411212021 44 Washtnsilon $rare Disadvantaged Business Enterprise (DBE) Department of l?ansportaton Written ConfirmatiOn DoCument See Contracl Provisions: DBE Document Submittal Requitements Disadvantaged Business Enlerprise Parlicipation THIS FORM SHALL ONLY BE SUBMITTED TO A DBE THAT IS LISTED ON THE CONTRACTOR'S DISADVANTAGED BUSINESS ENTERPRISE UTILIZATION CERTIFICATION, THE CONTRACTOR SHALL COMPLETE PARTA PRIOR TO SEND1NG TO THE DBE. PART.A: To be completed by thpbidder The entries below shall be consistent with what is shown on the Bidder's Disadvanaged Business Enterprise Utilization Certification. Failure to do so will result in Bid rejection. Contract Title:s ?l?fh sf on - 72nd Ave- S. to ft4th .Ave S. fEast Hishwav) Bidder's Business Name:,t t>t- DBE's Business Name:OBunAa lj*tr- t ^. EEa. L ua Description of DBE's Work:Softvts.) t tt:e- DollarAmount to beApplied Towards DBE Goal 1o45P- DollarAmount to be Subcontracted to DBE* 'Optional Field As an authorized representative of the Disadvantaged Business Enterprise, I confinn that we have been contacted by the Bidder with regard to the referenced project for the purpose of performing the Work described above. If the Bidder is awarded the Contract, we will enter into an agreement with the Bidder to participate in the project coirsistent with the infonnation provided in PartA of thisform. Tnt- tt \rt t ,azll 4Name (printed) Signature: Title: Address: Frft^ntPat lo4Z WE,T nr+rn€S gne€Er Kerur d{l ?Bo7c Date: t^l t3 zl DOTForm42'031 Revised 0712016 44 Provided ho Builders Exchange of WA, Inc. For usage CondlEions Agreement see www.bxhra.corn - Alwaye Verify Scal ^- -qr,,ra Disadvantaged Eusiness Enterprise (DBE)W H#g!ffiffi**,"o* wiinei coiiiirtisi pocimeit .Ses Contract Pr:ovisians: DBE Docunent Submitttil &eguirementt D is a dvdnl a ged Bu stn e* p Ente rprt w -P gil tsip alion TI{IS TORM SIIALT ONLY BE SUBMITTED TO A DBD T.TIAT IS LISTSD ON ffiE CONTBACTOR'S DISADVA.}ITAGBD BUSfi-IESS ENTERPRISE UTILIZATION CERTIFICATIOhI. TrrE CCINTRACTO3 SHALL COMFTETE PARTA PBIOR TO $ENDING rO TIIE DBB 'PARIAT To be completod by thebiildler The entries below shalt .bc eonsistent wlth what is shown on the Biddet's Disadvantaged Bushess Enterprise Utilization Certifisation. Failure to do so will resriltln Biil iejectioa. Conhact Titlei S. 2l2th St, Presorvation:7Znd,A,ve, S. to S4thAve' S. (East.V.allev }liehwav) Bidder's Susiness Name:u DBE's Busineqs Name:tc. Desoription of DBE :s Work: o oe P.{RT B: To be gompleted by the DisailvantagpdBusiness Snterprise As an authorized repiesentalive of the DisadvahtagedBusuress Errtet'prise,I Epnfrm that wcftave been contaoted by the Birtder with regard to the referenced project for the iturpose ofperfornaing the Work described above. lf.fire gi.dder is awarded-de G.ontract, we wi.ll enter into an agieement #th the Bidder to participate in tte project consis.tentwith the infonnatlon provjded in FartAof this fonn. Na-6 (printed): Signature: Title: Address: Andy Reece President PO Box 1531 Marysville, WA98270 Dete: 4lI3l202I DollarAmognt to be,{pflied Tpwards DBEGodl: DollarApouut to bb $ubp"A$ffrt#,ji, DBE*: DOTFom 422-031 Rovlsed 072016 44 REQUIRED CONTRACT PROVISIONS FEDERAL-AID CONSTRUCTION CONTRACTS FHWA-1273 * Revised May 1 ,2012 L Generalll. Nondiscriminationlll. Nonsegregated Facilities lV. Davis-Bacon and Related Act ProvisionsV. Contract Work Hours and Safety Standards Act Provisions Vl. Subletting or Assigning the Contract Vll. Safety: Accident Prevention Vlll. False Statements Concerning Highway Projects lX. lmplementation of Clean Air Act and Federal Water Pollution Control ActX. Compliance with Governmentwide Suspension and Debarment RequirementsXl. Certification Regarding Use of Contract Funds for Lobbying ATTACHMENTS A. Employment and Materials Preference for Appalachian Development Highway System or Appalachian LocalAccess Road Contracts (included in Appalachian contracts only) I. GENERAL 1. Form FHWA-1273 must be physically incorporated in each construction contract funded under Title 23 (excluding emergency contracts solely intended for debris removal). The contractor (or subcontractor) must insert this form in each subcontract and further require its inclusion in all lower tier subcontracts (excluding purchase orders, rental agreements and other agreements for supplies or services). The applicable requirements of Form FHWA-1273 are incorporated by reference for work done under any purchase order, rental agreement or agreement for other services. The prime contractor shall be responsible for compliance by any subcontractor, lower-tier subcontractor or service provider. Form FHWA-1273 must be included in all Federal-aid design-build contracts, in allsubcontracts and in lower tier subcontracts (excluding subcontracts for design services, purchase orders, rental agreements and other agreements for supplies or services). The design-builder shall be responsible for compliance by any subcontractor, lower-tier subcontractor or service provider. Contracting agencies may reference Form FHWA-1273 in bid proposal or request for proposal documents, however, the Form FHWA-1273 must be physically incorporated (not referenced) in all contracts, subcontracts and lower-tier subcontracts (excluding purchase orders, rental agreements and other agreements for supplies or services related to a construction contract). 2. Subject to the applicability criteria noted in the following sections, these contract provisions shall apply to allwork performed on the contract by the contractor's own organization and with 45 the assistance of workers under the contractor's immediate superintendence and to all work performed on the contract by piecework, station work, or by subcontract. g. A breach of any of the stipulations contained in these Required Contract Provisions may be sufficient grounds for withholding of progress payments, withholding of final payment, termination of the contract, suspension / debarment or any other action determined to be appropriate by the contracling agency and FHWA. 4. Selection of Labor: During the performance of this contract, the contractor shall not use convict labor for any purpose within the limits of a construction project on a Federal-aid highway unless it is labor performed by convicts who are on parole, supervised release, or probation. The term Federai-aid highway does not include roadways functionally classified as local roads or rural minor collectors. II. NONDISCRIMINATION The provisions of this section related to 23 CFR Part 230 are applicable to all Federal-aid consiruction contracts and to all related construction subcontracts of $10,000 or more. The provisions of 23 CFR Part 230 are not applicable to material supply, engineering, or architectural service contracts. ln addition, the contractor and all subcontractors must comply with the following policies: Executive Order 11246,41 CFR 60, 29 CFR 1625-1627,fille 23 USC Section 140, the Rehabilitation Act of 1973, as amended (29 USC 794), Title Vl of the Civil Rights Act of 1964, as amended, and related regulations including 49 CFR Parts 21, 26 and 27; and 23 CFR Parts 20A,230, and 633. The contractor and all subcontractors must comply with: the requirements of the Equal Opportunity Clause in 41 CFR 60-1.4(b)and, for all construction contracts exceeding $10,000, the'standard Federal Equal Employment Opportunity Construction Contract Specifications in 41 cFR 60-4.3. Note: The U.S. Department of Labor has exclusive authority to determine compliance with Executive Order 11246 and the policies of the Secretary of Labor including 41 CFR 60, and 29 CFR 1625-1627. The contracting agency and the FHWA have the authority and the responsibility to ensure compliance with Title 23 USC Section 140, the Rehabilitation Act of 1973, as amended (29 USC 794), and Title Vl of the Civil Rights Act of 1964, as amended, and related regulations including 49 CFR Parts 21 ,26 and 27; and 23 CFR Parts 200, 230, and 633. The following provision is adopted from 23 CFR 230, Appendix A, with appropriate revisions to conform to the U.S. Department of Labor (US DOL) and FHWA requirements. 1. Equal Emptoyment Opportunity: Equal employment opportunity (EEO) requirements not to discriminate indto take affirmative action to assure equal opportunity as set forth under laws, exeeutive orders, rules, regulations (28 CFR 35, 29 CFR 1630, 29 CFR 1625-1627,41 CFR 60 and 49 CFR 27) and orders of the Secretary of Labor as modified by the provisions_prescribed herein, and imposed pursuant to 23 U.S.C. 140 shall constitute the EEO and specific affirmative action standards for the contractor's project activities under this contract. The provisions of the Americans with Disabilities Act of 1990 (42 U.S.C. 12101et seq.) set forth under 28 CFR 35 and2g CFR 1630 are incorporated by reference in this contract. ln the execution of this 46 contract, the contractor agrees to comply with the following minimum specific requirement activities of EEO: a. The contractor willwork with the contracting agency and the Federal Government to ensure that it has made every good faith effort to provide equal opportunity with respect to all of its terms and conditions of employment and in their review of activities under the contract. b. The contractor will accept as its operating policy the following statement: "lt is the policy of this Company to assure that applicants are employed, and that employees are treated during employment, without regard to their race, religion, sex, color, national origin, age or disability. Such action shall include: employment, upgrading, demotion, or transfer; recruitment or recruitment advertising; layoff or termination; rates of pay or other forms of compensation; and selection for training, including apprenticeship, pre-apprenticeship, and/or onthe-job training." 2. EEO Officer: The contractor will designate and make known to the contracting officers an EEO Officer who will have the responsibility for and must be capable of effectively administering and promoting an active EEO program and who must be assigned adequate authority and responsibility to do so. 3. Dissemination of Policy: All members of the contractor's staff who are authorized to hire, supervise, promote, and discharge employees, or who recommend such action, or who are substantially involved in such action, will be made fully cognizant of, and will implement, the contractor's EEO policy and contractual responsibilities to provide EEO in each grade and classification of employment. To ensure that the above agreement will be met, the following actions will be taken as a minimum: a. Periodic meetings of supervisory and personnel office employees will be conducted before the start of work and then not less often than once every six months, at which time the contractor's EEO policy and its implementation will be reviewed and explained. The meetings will be conducted by the EEO Officer. b. All new supervisory or personnel office employees will be given a thorough indoctrination by the EEO Officer, covering all major aspects of the contractor's EEO obligations within thirty days following their reporting for duty with the contractor. c. All personnel who are engaged in direct recruitment for the project will be instructed by the EEO Officer in the contractor's procedures for locating and hiring minorities and women. d. Notices and posters setting forth the contractor's EEO policy will be placed in areas readily accessible to employees, applicants for employment and potential employees. e. The contractor's EEO policy and the procedures to implement such policy will be brought to the attention of employees by means of meetings, employee handbooks, or other appropriate means. 4. Recruitment: When advertising for employees, the contractor will include in all advertisements for employees the notation: "An Equal Opportunity Employer." All such advertisements will be placed in publications having a large circulation among minorities and women in the area from which the project work force would normally be derived. 47 a. The contractor will, unless precluded by a valid bargaining agreement, conduct systematic and direct recruitment through public and private employee referral sources likely to yield qualified minorities and women. To meet this requirement, the contractor will identify sources of potential minority group employees, and establish with such identified sources procedures whereby minority ind women applicants may be referred to the contractor for employment consideration. b. ln the event the contractor has a valid bargaining agreement providing for exclusive hiring hall referrals, the contractor is expected to observe the provisions of that agreement to the extent that the system meets the contractor's compliance with EEO contract provisions. Where implementation of such an agreement has the effect of discriminating against minorities or women, or obligates the contractor to do the same, such implementation violates Federal nond iscrimination provisions. c. The contractor will encourage its present employees to refer minorities and women as applicants for employment. lnformation and procedures with regard to referring such applicants will be discussed with emploYees. 5. personnelAclions: Wages, working conditions, and employee benefits shall be established and administered, and personnel actions of every type, including hiring, upgrading, promotion, transfer, demotion, layoff, and termination, shall be taken without regard to race, color, religion, sex, national origin, age or disability. The following procedures shall be followed: a. The contractor will conduct periodic inspections of project sites to insure that working conditions and employee facilities do not indicate discriminatory treatment of project site personnel. b. The contractor will periodically evaluate the spread of wages paid within each classification to determine any evidence of discriminatory wage practices' c. The contractor will periodically review selected personnel actions in depth to determine whether there is evidence of discrimination. Where evidence is found, the contractor will prompfly take corrective action. lf the review indicates that the discrimination may extend beyond the actions reviewed, such corrective action shall include all affected persons. d. The contractor will promptly investigate all complaints of alleged discrimination made to the contractor in connection with its obligations under this contract, will attempt to resolve such complaints, and will take appropriate corrective action within a reasonable time. lf the investigation indicates that the discrimination may affect persons other than the complainant, such corrective action shall include such other persons. Upon completion of each investigation, the contractor will inform every complainant of all of their avenues of appeal. 6. Training and Promotion: a. The contractor will assist in locating, qualifying, and increasing the skills of minorities and women who are applicants for employment or current employees. Such efforts should be aimed at developing fulljourney level status employees in the type of trade or job classification involved. 48 b. Consistent with the contractor's work force requirements and as permissible under Federal and State regulations, the contractor shall make full use of training programs, i.e., apprenticeship, and on{he-job training programs for the geographical area of contract performance. ln the event a special provision for training is provided under this contract, this subparagraph will be superseded as indicated in the special provision. The contracting agency may reserve training positions for persons who receive welfare assistance in accordance with 23 U.S.C. 140(a). c. The contractor will advise employees and applicants for employment of available training programs and entrance requirements for each. d. The contractor will periodically review the training and promotion potential of employees who are minorities and women and will encourage eligible employees to apply for such training and promotion. 7. Unions: lf the contractor relies in whole or in part upon unions as a source of employees, the contractor will use good faith efforts to obtain the cooperation of such unions to increase opportunities for minorities and women. Actions by the contractor, either directly or through a contractor's association acting as agent, will include the procedures set forth below: a. The contractor will use good faith efforts to develop, in cooperation with the unions, joint training programs aimed toward qualifying more minorities and women for membership in the unions and increasing the skills of minorities and women so that they may qualify for higher paying employment. b. The contractor will use good faith efforts to incorporate an EEO clause into each union agreement to the end that such union will be contractually bound to refer applicants without regard to their race, color, religion, sex, national origin, age or disability. c. The contractor is to obtain information as to the referral practices and policies of the labor union except that to the extent such information is within the exclusive possession of the labor union and such labor union refuses to furnish such information to the contractor, the contractor shall so certifu to the contracting agency and shall set forth what efforts have been made to obtain such information. d. ln the event the union is unable to provide the contractor with a reasonable flow of referrals within the time limit set forth in the collective bargaining agreement, the contractor will, through independent recruitment efforts, fillthe employment vacancies without regard to race, color, religion, sex, national origin, age or disability; making full efforts to obtain qualified and/or qualifiable minorities and women. The failure of a union to provide sufficient referrals (even though it is obligated to provide exclusive referrals under the terms of a collective bargaining agreement) does not relieve the contractor from the requirements of this paragraph. ln the event the union referral practice prevents the contractor from meeting the obligations pursuant to Executive Order 11246, as amended, and these special provisions, such contractor shall immediately notify the contracting agency. L Reasonable Accommodation for Applicants / Employees with Disabilities: The contractor must be familiar with the requirements for and comply with the Americans with Disabilities Act and all rules and regulations established there under. Employers must provide reasonable accommodation in all employment activities unless to do so would cause an undue hardship. 49 g. Selection of Subcontractors, Procurement of Materials and Leasing of Equipment: The contractor shall not discriminate on the grounds of race, color, religion, sex, national origin, age or disability in the selection and retention of subcontractors, including procurement of materials and leasei of equipment. The contractor shall take all necessary and reasonable steps to ensure nondiscrimination in the administration of this contract. a. The contractor shall notify all potential subcontractors and suppliers and lessors of their EEO obligations under this contract. b. The contractor will use good faith efforts to ensure subcontractor compliance with their EEO obligations. 10. Assurance Required by 49 GFR 26'13(b): a. The requirements of 49 CFR Part 26 and the State DOT's U.S. DOT-approved DBE program are incorporated by reference. b. The contractor or subcontractor shall not discriminate on the basis of race, color, national origin, or sex in the performance of this contract. The contractor shall carry out applicable requirements of 49 CFR Part 26 in the award and administration of DOT-assisted contracts. Failure by the contractor to carry out these requirements is a material breach of this contract, which may result in the termination of this contract or such other remedy as the contracting agency deems apProPriate. 11. Records and Reports: The contractor shall keep such records as necessary to document compliance with the EEO requirements. Such records shall be retained for a period of three yeari following the date of the final payment to the contractor for all contract work and shall be bvailable at reisonable limes and places for inspection by authorized representatives of the contracting agency and the FHWA. a. The records kept by the contractor shall document the following: (1) The number and work hours of minority and non-minority group members and women employed in each work classification on the project; (2) The progress and efforts being made in cooperation with unions, when applicable, to increase employment opportunities for minorities and women; and (3) The progress and efforts being made in locating, hiring, training, qualiffing, and upgrading minorities and women; b. The contractors and subcontractors will submit an annual report to the contracting agency each July for the duration of the project, indicating the number of minority, women, and non- minority group employees currently engaged in each work classification required by the contract wort<. This information is to be reported on Form FHWA-1391. The staffing data should represent the project work force on board in all or any part of the last payroll period preceding th6 end of July. lf on-the-job training is being required by special provision, the contractor will be required to collect and report training data. The employment data should reflect the work force on board during all or any part of the last payroll period preceding the end of July. 50 III. NONSEGREGATED FACILITIES This provision is applicable to all Federal-aid construction contracts and to all related construction subcontracts of $10,000 or more. The contractor must ensure that facilities provided for employees are provided in such a manner that segregation on the basis of race, color, religion, sex, or national origin cannot result. The contractor may neither require such segregated use by written or oral policies nor tolerate such use by employee custom. The contractor's obligation extends further to ensure that its employees are not assigned to perform their services at any location, under the contracior's control, where the facilities are segregated. The term "facilities" includes waiting rooms, work areas, restaurants and other eating areas, time clocks, restrooms, washrooms, locker rooms, and other storage or dressing areas, parking lots, drinking fountains, recreation or entertainment areas, transportation, and housing provided for employees. The contractor shall provide separate or single-user restrooms and necessary dressing or sleeping areas to assure privacy between sexes. IV. DAVIS-BACON AND RELATED ACT PROVISIONS This section is applicable to all Federal-aid construction projects exceeding $2,000 and to all related subcontracts and lower-tier subcontracts (regardless of subcontract size). The requirements apply to all prcjects located within the right-of-way of a roadway that is functionally classified as Federal-aid highway. This excludes roadways functionally classified as local roads or rural minor collectors, which are exempt. Contracting igencies may elect to apply these requirements to other projects. The following provisions are from the U.S. Department of Labor regulations in 29 CFR 5.5 "Contract provisions and related matters" with minor revisions to conform to the FHWA-1273 format and FHWA program requirements. 1. Minimum wages a. All laborers and mechanics employed or working upon the site of the work, will be paid unconditionally and not less often than once a week, and without subsequent deduction or rebate on any account (except such payroll deductions as are permitted by regulations issued by the Secretary of Labor under the Copeland Act (29 CFR part 3)), the full amount of wages and bona fide fringe benefits (or cash equivalents thereof) due at time of payment computed at rates not less than those contained in the wage determination of the Secretary of Labor which is attached hereto and made a part hereof, regardless of any contractual relationship which may be alleged to exist between the contractor and such laborers and mechanics. Contributions made or costs reasonably anticipated for bona fide fringe benefits under section 1(bX2) of the Davis-Bacon Act on behalf of laborers or mechanics are considered wages paid to such laborers or mechanics, subject to the provisions of paragraph 1.d. of this section; also, regular contributions made or costs incurred for more than a weekly period (but not less often than quarterly) under plans, funds, or programs which cover the particular weekly period, are deemed to be constructively made or incurred during such weekly period. Such laborers and 51 mechanics shall be paid the appropriate wage rate and fringe benefits on the wage determination for the classification of work actually performed, without regard to skill, except as provided in 29 CFR 5.5(a)(4). Laborers or mechanics performing work in more than one classification may be compensated at the rate specified for each classification for the time actually worked therein: Provided, That the employer's payroll records accurately set forth the 6me spent in each classification in which work is performed. The wage determination (including any additional classification and wage rates conformed under paragraph 1.b. of this section) and the Davis-Bacon poster (WH-1321) shall be posted at alltimes by the contractor and its subcontractors atthe site of the work in a prominent and accessible place where it can be easily seen by the workers. b. (1) The contracting officer shall require that any class of laborers or mechanics, including helpiri, which is not liited in the wage determination and which is to be employed under the contract shall be classified in conformance with the wage determination. The contracting officer shall approve an additional classification and wage rate and fringe benefits therefore only when the following criteria have been met: (i) The work to be performed by the classification requested is not performed by a classification in the wage determination; and (ii) The classification is utilized in the area by the construction industry; and (iii) The proposed wage rate, including any bona fide fringe benefits, bears a reasonable relationship to the wage rates contained in the wage determination. (2) lf the contractor and the laborers and mechanics to be employed in the classification (if known), or their representatives, and the contracting officer agree on the classification and wage iite (including the amount designated for fringe benefits where appropriale), a report of the-action taken shill be sent by the contracting officer to the Administrator of the Wage and Hour Division, Employment Standards Administration, U.S. Department of Labor, Washington, DC 20210. The Administrator, or an authorized representative, will approve, modify, or disapprove every additional classification action within 30 days of receipt and so advise the contricting officer or will notify the contracting officer within the 30-day period that additional time is necessary. (3) ln the event.the contractor, the laborers or mechanics to be employed in the classification oi tneir representatives, and the contracting officer do not agree on the proposed classification and wage rate (lncluding the amount designated for fringe benefits, where appropriate), the contracting officer shall iefer the questions, including the views of all interested parties and the recommendation of the contracting officer, to the Wage and Hour Administrator for determination. The Wage and Hour Administrator, or an authorized representative, will issue a determination within 30 days of receipt and so advise the contracting officer or will notify the contracting officer within the 30-day period that additionaltime is necessary. (4) The wage rate (including fringe benefits where appropriate) determined pursuant to piragraphs t.O.(Z) oi t.n.(g)bt this section, shall be paid to all workers performing work in the classification under this contract from the first day on which work is performed in the classification. 52 c. Whenever the minimum wage rate prescribed in the contract for a class of laborers or mechanics includes a fringe benefit which is not expressed as an hourly rate, the contractor shall either pay the benefit as stated in the wage determination or shall pay another bona fide fringe benefit or an hourly cash equivalent thereof. d. lf the contractor does not make payments to a trustee or other third person, the contractor may consider as part of the wages of any laborer or mechanic the amount of any costs reasonably anticipated in providing bona fide fringe benefits under a plan or program, Provided, That the Secretary of Labor has found, upon the written request of the contractor, that the applicable standards of the Davis-Bacon Act have been met. The Secretary of Labor may require the contractor to set aside in a separate account assets for the meeting of obligations under the plan or program. 2. Withholding The contracting agency shall upon its own action or upon written request of an authorized representative of the Department of Labor, withhold or cause to be withheld from the contractor under this contract, or any other Federal contract with the same prime contractor, or any other federally-assisted contract subject to Davis-Bacon prevailing wage requirements, which is held by the same prime contractor, so much of the accrued payments or advances as may be considered necessary to pay laborers and mechanics, including apprentices, trainees, and helpers, employed by the contractor or any subcontractor the full amount of wages required by the contract. ln the event of failure to pay any laborer or mechanic, including any apprentice, trainee, or helper, employed or working on the site of the work, all or part of the wages required by the contract, the contracting agency may, after written notice to the contractor, take such action as may be necessary to cause the suspension of any further payment, advance, or guarantee of funds until such violations have ceased. 3. Payrolls and basic records a. Payrolls and basic records relating thereto shall be maintained by the contractor during the course of the work and preserved for a period of three years thereafter for all laborers and mechanics working at the site of the work. Such records shall contain the name, address, and social security number of each such worker, his or her correct classification, hourly rates of wages paid (including rates of contributions or costs anticipated for bona fide fringe benefits or cash equivalents thereof of the types described in section 1(bX2XB) of the Davis-Bacon Act), daily and weekly number of hours worked, deductions made and actualwages paid. Whenever the Secretary of Labor has found under 29 CFR 5.5(aXlXiv) that the wages of any laborer or mechanic include the amount of any costs reasonably anticipated in providing benefits under a plan or program described in section 1(bX2XB) of the Davis-Bacon Act, the contractor shall maintain records which show that the commitment to provide such benefits is enforceable, that the plan or program is financially responsible, and that the plan or program has been communicated in writing to the laborers or mechanics affected, and records which show the costs anticipated or the actual cost incurred in providing such benefits. Contractors employing apprentices or trainees under approved programs shall maintain written evidence of the registration of apprenticeship programs and certification of trainee programs, the registration of the apprentices and trainees, and the ratios and wage rates prescribed in the applicable programs. 53 b. (1) The contractor shall submit weekly for each week in which any contract work is performed a copy of all payrolls to the contracting agency. The payrolls submitted shall set out accurately and completely all of the information required to be maintained under 29 CFR 5.5(aX3Xr), except that full social security numbers and home addresses shall not be included on weekly transmittals. lnstead the payrolls shallonly need to include an individually identifying number for each employee ( e.g. , the last four digits of the employee's social security number). The required weekly payroll information may be submitted in any form desired. Optional Form WH-347 is available for this purpose from the Wage and Hour Division Web site at http://www.dol.gov/esa/whd/forms/wh347instr.htm or its successor site. The prime contractor is responsible for the submission of copies of payrolls by all subcontractors. Contractors and subcontractors shall maintain the full social security number and current address of each covered worker, and shall provide them upon request to the contracting agency for transmission to the State DOT, the FHWA or the Wage and Hour Division of the Department of Labor for purposes of an investigation or audit of compliance with prevailing wage requirements. lt is not a violation of this section for a prime contractor to require a subcontractor to provide addresses and social security numbers to the prime contractor for its own records, without weekly submission to the contracting agency.. (2) Each payroll submitted shall be accompanied by a "statement of Compliance," signed by the contractor or subcontractor or his or her agent who pays or supervises the payment of the persons employed under the contract and shall certify the following: (i) That the payroll for the payroll period contains the information required to be provided under 95.5 (aX3Xii) of Regulations, 29 CFR part 5, the appropriate information is being maintained under S5.5 (aX3Xi) of Regulations, 29 CFR part 5, and that such information is correct and complete; (ii) That each laborer or mechanic (including each helper, apprentice, and trainee) employed on the contract during the payroll period has been paid the fullweekly wages earned, without rebate, either directly or indirectly, and that no deductions have been made either directly or indirectly from the full wages earned, other than permissible deductions as set forth in Regulations, 29 CFR part 3; (iii) That each laborer or mechanic has been paid not less than the applicable wage rates and fringe benefits or cash equivalents for the classification of work performed, as specified in the applicable wage determination incorporated into the contract- (3) The weekly submission of a properly executed certification set forth on the reverse side of Optional Form WH-347 shall satisfy the requirement for submission of the "Statement of Compliance" required by paragraph 3.b.(2) of this section. (4) The falsification of any of the above certifications may subject the contractor or subcontractor to civil or criminal prosecution under section 1001 of title 1B and section 231 ot title 31 of the United States Code. c. The contractor or subcontractor shall make the records required under paragraph 3.a. of this section available for inspection, copying, or transcription by authorized representatives of the contracting agency, the State DOT, the FHWA, or the Department of Labor, and shall permit such representatives to interview employees during working hours on the job. lf the contractor or subcontractor fails to submit the required records or to make them available, the FHWA may, 54 after written notice to the contractor, the contracting agency or the State DOT, take such action as may be necessary to cause the suspension of any further payment, advance, or guarantee of funds. Furthermore, failure to submit the required remrds upon request or to make such records available may be grounds for debarment action pursuant to 2g CFR S.12. 4. Apprentices and trainees a. Apprentices (programs of the USDOL). Apprentices will be permitted to work at less than the predetermined rate for the work they performed when they are employed pursuant to and individually registered in a bona fide apprenticeship program registered with the U.S. Department of Labor, Employment and Training Administration, Office of Apprenticeship Training, Employer and Labor Services, or with a State Apprenticeship Agency recognized by the Office, or if a person is employed in his or her first 90 days of probationary employment as an apprentice in such an apprenticeship program, who is not individually registered in the program, but who has been certified by the Office of Apprenticeship Training, Employer and Labor Services or a State Apprenticeship Agency (where appropriate)to be eligible for probationary employment as an apprentice. The allowable ratio of apprentices to journeymen on the job site in any craft classification shall not be greater than the ratio permitted to the contractor as to the entire work force under the registered program. Any worker listed on a payroll at an apprentice wage rate, who is not registered or othenrvise employed as stated above, shall be paid not less than the applicable wage rate on the wage determination for the classification of work actually performed. In addition, any apprentice performing work on the job site in excess of the ratio permitted under the registered program shall be paid not less than the applicable wage rate on the wage determination for the work actually performed. Where a contractor is performing construction on a project in a locality other than that in which its program is registered, the ratios and wage rates (expressed in percentages of the journeyman's hourly rate) specified in the contractor's or subcontractor's registered program shall be observed. Every apprentice must be paid at not less than the rate specified in the registered program for the apprentice's level of progress, expressed as a percentage of the journeymen hourly rate specified in the applicable wage determination. Apprentices shall be paid fringe benefits in accordance with the provisions of the apprenticeship program. lf the apprenticeship program does not specify fringe benefits, apprentices must be paid the full amount of fringe benefits listed on the wage determination for the applicable classification. lf the Administrator determines that a different practice prevails for the applicable apprentice classification, fringes shall be paid in accordance with that determination. ln the event the Office of Apprenticeship Training, Employer and Labor Services, or a State Apprenticeship Agency recognized by the Office, withdraws approval of an apprenticeship program, the contractor will no longer be permitted to utilize apprentices at less than the applicable predetermined rate for the work performed until an acceptable program is approved b. Trainees (programs of the USDOL). Except as provided in 29 CFR 5.16, trainees will not be permitted to work at less than the predetermined rate for the work performed unless they are employed pursuant to and 55 individually registered in a program which has received prior approval, evidenced by formal certification by the U.S. Department of Labor, Employment and Training Administration. The ratio of trainees to journeymen on the job site shall not be greater than permitted under the plan approved by the Employment and Training Administration. Every trainee must be paid at not less than the rate specified in the approved program for the trainee's level of progress, expressed as a percentage of the journeyman hourly rate specified in the applicable wage determination. Trainees shall be paid fringe benefits in accordance with the provisions of the trainee program. lf the trainee program does not mention fringe benefits, trainees shall be paid the full amount of fringe benefits listed on the wage determination unless the Administrator of the Wage and Hour Division determines that there is an apprenticeship program associated with the corresponding journeyman wage rate on the wage determination which provides for less than full fringe benefits for apprentices. Any employee listed on the payroliat a trainee rate who is not registered and participating in a training plan approved by the'Employment and Training Administration shall be paid not less than the applicable wage rate on the wage determination for the classification of work actually performed. ln addition, any trainee performing work on the job site in excess of the ratio permitted under the registered program shall be paid not less than the applicable wage rate on the wage determination for the work actually performed. ln the event the Employment and Training Administration withdraws approval of a training program, the contractor will no longer be permitted to utilize trainees at less than the applicable predetermined rate for the work performed until an acceptable program is approved. c. Equal employment opportunity. The utilization of apprentices, trainees and journeymen under this part shall be in conformity with the equal employment opportunity requirements of Executive Order 11246, as amended, and 29 CFR part 30. d. Apprentices and Trainees (programs of the U-S. DOT). Apprentices and trainees working under apprenticeship and skill training programs which have been certified by the Secretary of Transportation as promoting EEO in connection with Federal- aid highway construction programs are not subject to the requirements of paragraph 4 of this Section lV. The straight time hourly wage rates for apprentices and trainees under such programs will be established by the particular programs. The ratio of apprentices and trainees to journeymen shall not be greater than permitted by the terms of the particular program. 5. Gompliance with Copeland Act requirements. The contractor shall comply with the requirements of 29 CFR part 3, which are incorporated by reference in this contract. 6. Subcontracts. The contractor or subcontractor shall insert Form FHWA'1273 in any subcontracts and also require the subcontractors to include Form FHWA-1273 in any lower tier subcontracts. The prime contractor shall be responsible for the compliance by any subcontractor or lower tier subcontractor with all the contract clauses in 29 CFR 5.5, 7. Contract termination: debarment. A breach of the contract clauses in 29 CFR 5.5 may be grounds for termination of the contract, and for debarment as a contractor and a subcontractor as provided in 29 CFR 5.12. 56 8. Gompliance with Davis-Bacon and Related Act requirements. All rulings and interpretations of the Davis-Bacon and Related Acts contained in 29 CFR parts 1, 3, and 5 are herein incorporated by reference in this contract. 9. Disputes concerning labor standards. Disputes arising out of the labor standards provisions of this contract shall not be subject to the general disputes clause of this contract. Such disputes shall be resolved in accordance with the procedures of the Department of Labor set forth in 29 CFR parts 5, 6, and 7. Disputes within the meaning of this clause include disputes between the contractor (or any of its subcontractors) and the contracting agency, the U.S. Department of Labor, or the employees or their representatives. 10. Certification of eligibility. a. By entering into this contract, the contractor certifies that neither it (nor he or she) nor any person or firm who has an interest in the contractor's firm is a person or flrm ineligible to be awarded Government contracts by virtue of section 3(a) of the Davis-Bacon Act or 29 CFR 5.12(aX1). b. No part of this contract shall be subcontracted to any person or firm ineligible for award of a Government contract by virtue of section 3(a) of the Davis-Bacon Act or 29 CFR 5.12(aX1). c. The penalty for making false statements is prescribed in the U.S. Criminal Code, 18 U.S.C 1001. V. CONTRACT WORK HOURS AND SAFETY STANDARDS ACT The following clauses apply to any Federal-aid construction contract in an amount in excess of $100,000 and subject to the overtime provisions of the Contract Work Hours and Safety Standards Act. These clauses shall be inserted in addition to the clauses required by 29 CFR 5.5(a) or 29 CFR 4.6. As used in this paragraph, the terms laborers and mechanics include watchmen and guards. 1. Overtime requirements. No contractor or subcontractor contracting for any part of the contract work which may require or involve the employment of laborers or mechanics shall require or permit any such laborer or mechanic in any workweek in which he or she is employed on such work to work in excess of forty hours in such workweek unless such laborer or mechanic receives compensation at a rate not less than one and one-half times the basic rate of pay for all hours worked in excess of forty hours in such workweek. 2. Violation; liability for unpaid wages; liquidated damages. ln the event of any violation of the clause set forth in paragraph (1.) of this section, the contractor and any subcontractor responsible therefor shall be liable for the unpaid wages. ln addition, such contractor and subcontractor shall be liable to the United States (in the case of work done under contract for the District of Columbia or a territory, to such District or to such territory), for liquidated damages. Such liquidated damages shall be computed with respect to each individual laborer or mechanic, including watchmen and guards, employed in violation of the clause set forth in paragraph (1 .) of this section, in the sum of $10 for each calendar day on which such individual 57 was required or permitted to work in excess of the standard workweek of forty hours without payment of the overtime wages required by the clause set forth in paragraph (1,) of this section. 3. Withholding for unpaid wages and liquidated damages. The FHWA or the contacting agency shall u[on its own action or upon written request of an authorized representative of the O-epariment of Labor withhold or cause to be withheld, from any moneys payable on account of work performed by the contractor or subcontractor under any such contract or any other Federal contract with the same prime contractor, or any other federally-assisted contract subject to the Contract Work Hours and Safety Standards Act, which is held by the same prime contractor, such sums as may be determined to be necessary to satisff any liabilities of such contractor or subcontractor for unpaid wages and liquidated damages as provided in the clause set forth in paragraph (2.) of this section. 4. Subcontracts. The contractor or subcontractor shall insert in any subcontracts the clauses set forth in paragraph (1.) through (4.) of this section and also a clause requiring the subcontraciors tb include these clauses in any lower tier subcontracts. The prime contractor shall be responsible for compliance by any subcontractor or lower tier subcontractor with the clauses set forth in paragraphs (1.) through (4.) of this section. VI. SUBLETTING OR ASSIGNING THE CONTRACT This provision is applicable to all Federal-aid construction contraets on the National Highway System. 1. The contractor shall perform with its own organization contract work amounting to not less than 30 percent (or a gieater percentage if specified elsewhere in the contract) of the total original contract price, excluding any specialty items designated by the contracting agency' Sp6cialty items may be performed by subcontract and the amount of any such specialty items performeO may be deducted from the total original contract price before computing the amount of work required to be performed by the contractor's own organization (23 CFR 635'116). a. The term "perform work with its own organization" refers to workers employed or leased by the prime contractor, and equipment owned or rented by the prime contractor, with or without operators. Such term does not include employees or equipment of a subcontractor or lower tier subcontractor, agents of the prime contractor, or any other assignees. The term may include payments for inJcosts of hiring leased employees from an employee leasing firm meeting all relevant Federal and State regulatory requirements. Leased employees may only be included in this term if the prime contractor meets all of the following conditions: (1) the prime contractor maintains control over the supervision of the dayto-day activities of the leased employees; (2) the prime contractor remains responsible for the quality of the work of the leased employees; (g)1ie prime contractor retains all power to accept or exclude individual employees from work on the project; and 58 (4) the prime contractor remains ultimately responsible for the payment of predetermined minimum wages, the submission of payrolls, statements of compliance and all other Federal regulatory requirements. b. "Specialty ltems" shall be construed to be limited to work that requires highly specialized knowledge, abilities, or equipment not ordinarily available in the type of contracting organizations qualified and expected to bid or propose on the contract as a whole and in general are to be limited to minor components of the overall contract. 2. The contract amount upon which the requirements set forth in paragraph (1) of Section Vl is computed includes the cost of material and manufactured products which are to be purchased or produced by the contractor under the contract provisions. 3. The contractor shall furnish (a) a competent superintendent or supervisor who is employed by the firm, has full authority to direct performance of the work in accordance with the contract requirements, and is in charge of all construction operations (regardless of who performs the work) and (b) such other of its own organizational resources (supervision, management, and engineering services) as the contracting otficer determines is necessary to assure the performance of the contract. 4. No portion of the contract shall be sublet, assigned or otherwise disposed of except with the written consent of the contracting officer, or authorized representative, and such consent when given shall not be construed to relieve the contractor of any responsibility for the fulfillment of the contract. Written consent will be given only after the contracting agency has assured that each subcontract is evidenced in writing and that it contains all pertinent provisions and requirements of the prime contract. 5. The 30% self-performance requirement of paragraph (1) is not applicable to design-build contracts; however, contracting agencies may establish their own self-performance requirements. Vll. SAFETY: AGCIDENT PREVENTION This provision is applicable to all Federal-aid construction contracts and to all related subcontracts. 1. ln the performance of this contract the contractor shall comply with all applicable Federal, State, and local laws governing safety, health, and sanitation (23 CFR 635). The contractor shall provide all safeguards, safety devices and protective equipment and take any other needed actions as it determines, or as the contracting officer may determine, to be reasonably necessary to protect the life and health of employees on the job and the safety of the public and to protect property in connection with the performance of the work covered by the contract. 2. lt is a condition of this contract, and shall be made a condition of each subcontract, which the contractor enters into pursuant to this contract, that the contractor and any subcontractor shall not permit any employee, in performance of the contract, to work in surroundings or under conditions which are unsanitary,hazardous or dangerous to his/her health or safety, as determined under construction safety and health standards (29 CFR 1926) promulgated by the Secretary of Labor, in accordance with Section 1A7 d the Contract Work Hours and Safety Standards Act (40 U.S.C. 3704). 59 3. Pursuant to 29 CFR 1926.3, it is a condition of this contract that the Secretary of Labor or authorized representative thereof, shall have right of entry to any site of contract performance to inspect or investigate the matter of compliance with the construction safety and health standards and to carry out the duties of the Secretary under Section 107 of the Contract Work Hours and Safety Standards Act (40 U.S.C.3704). VIII. FALSE STATEMENTS CONCERNING HIGHWAY PROJECTS This provision is applicable to all Federal-aid construction contracts and to all related subcontracts. ln order to assure high quality and durable construction in conformity with approved plans and specifications and a high degree of reliability on statements and representations made by engineers, contractors, suppliers, and workers on Federal-aid highway projects, it is essential thal all persons concerned with the project perform their functions as carefully, thoroughly, and honestly as possible. Willful falsification, distortion, or misrepresentation with respect to any facts reiated to the project is a violation of Federal law. To prevent any misunderstanding regarding the seriousness of these and similar acts, Form FHWA-1022 shall be posted on each feOeral-iia highway project (23 CFR 635) in one or more places where it is readily available to all persons concerned with the project: 18 U.S.C. 1020 reads as follows: "Whoever, being an officer, agent, or employee of the United States, or of any State or Territory, or whoever, whether a person, association, firm, or corporation, knowingly makes any false stitement, false representation, or false report as to the character, quality, quantity, or cost of the material used or to be used, or the quantity or quality of the work performed or to be performed, or the cost thereof in connection with the submission of plans, maps, specifications, contracts, or costs of construction on any highway or related project submitted for approval to the Secretary of Transportation; or Whoever knowingly makes any false statement, false representation, false report or false claim with respect to the character, quality, quantity, or cost of any work performed or to be performed, or materials furnished or to be furnished, in connection with the construction of any highway or related project approved by the Secretary of Transportation; or Whoever knowingly makes any false statement or false representation as to material fact in any statement, certificate, or report submitted pursuant to provisions of the Federal-aid Roads Aci approved July 1, 1916, (39 Stat. 355), as amended and supplemented; Shall be fined under this title or imprisoned not more than 5 years or both." IX. IMPLEMENTATION OF CLEAN AIR ACT AND FEDERAL WATER POLLUTION CONTROL ACT This provision is applicable to all Federal-aid construction contracts and to all related subcontracts. 60 By submission of this bid/proposal or the execution of this contract, or subcontract, as appropriate, the bidder, proposer, Federal-aid construction contractor, or subcontractor, as appropriate, will be deemed to have stipulated as follows: 1 . That any person who is or will be utilized in the performance of this contract is not prohibited from receiving an award due to a violation of Section 508 of the Clean Water Act or Section 306 of the Clean Air Act. 2. That the contractor agrees to include or cause to be included the requirements of paragraph (1) of this Section X in every submntract, and further agrees to take such action as the contracting agency may direct as a means of enforcing such requirements. X. CERTIFICATION REGARDING DEBARMENT, SUSPENSION, INELIGIBILITY AND VOLUNTARY EXCLUSION This provision is applicable to all Federal-aid construction contracts, design-build contracts, subcontracts, lower-tier subcontracts, purchase orders, lease agreements, consultant contracts or any other covered transaction requiring FHWA approval or that is estimated to cost $25,000 or more - as defined in 2 CFR Parts 180 and 1200, 1. lnstructions for Certification - First Tier Participants: a. By signing and submitting this proposal, the prospective first tier participant is providing the certification set out below. b. The inability of a person to provide the certification set out below will not necessarily result in denial of participation in this covered transaction. The prospective first tier participant shall submit an explanation of why it cannot provide the certification set out below. The certification or explanation will be considered in connection with the department or agency's determination whether to enter into this transaction. However, failure of the prospective first tier participant to furnish a certification or an explanation shall disqualify such a person from participation in this transaction. c. The certification in this clause is a material representation of fact upon which reliance was placed when the contracting agency determined to enter into this transaction. lf it is later determined that the prospective participant knowingly rendered an erroneous certification, in addition to other remedies available to the Federal Government, the contracting agency may terminate this transaction for cause of default. d. The prospective first tier participant shall provide immediate written notice to the contracting agency to whom this proposal is submitted if any time the prospective first tier participant learns that its certification was erroneous when submitted or has become erroneous by reason of changed circumstances. e. The terms "covered transaction," "debarred," "suspended," "ineligible," "participant," "person," "principal," and "voluntarily excluded," as used in this clause, are defined in 2 CFR Parts 180 and 1200. "First Tier Covered Transactions" refers to any covered transaction between a grantee or subgrantee of Federal funds and a participant (such as the prime or 61 general contract). "Lower Tier Covered Transactions" refers to any covered transaction under a First Tier Covered Transaction (such as subcontracts). "First Tier Participant" refers to the participant who has entered into a covered transaction with a grantee or subgrantee of Federal iunds (such as the prime or general contractor). "Lower Tier Participant" refers any participant who has entered into a covered transaction with a First Tier Participant or other Lower Tier Participants (such as subcontractors and suppliers). f. The prospective first tier participant agrees by submitting this proposal that, should the proposed covered transaction be entered into, it shall not knowingly enter into any lower tier covered transaction with a person who is debarred, suspended, declared ineligible, or voluntarily excluded from participation in this covered transaction, unless authorized by the department or agency entering into this transaction. g. The prospective first tier participant further agrees by submitting this proposal that it will inciude the clause titled "Certification Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion-Lower Tier Covered Transactions," provided by the department or contracting agency, entering into this covered transaction, without modification, in all lower tier covered trbnsactions and in all solicitations for lower tier covered transactions exceeding the $25,000 threshold. h. A participant in a covered transaction may rely upon a certification of a prospective participant in a lower tier covered transaction that is not debarred, suspended, ineligible, or voluntarily excluded from the covered transaction, unless it knows that the certification is erroneous. A participant is responsible for ensuring that its principals are not suspended, debarred, or othenruise ineligible to participate in covered transactions. To verify the eligibility of its principals, as well as the eligibility of any lower tier prospective participants, each participant may, but is not required to, check the Excluded Parties List System website (https://www.epls.qov/), which is compiled by the General Services Administration. i. Nothing contained in the foregoing shall be construed to require the establishment of a system of records in order to render in good faith the certification required by this clause. The knowledge and information of the prospective participant is not required to exceed that which is normally possessed by a prudent person in the ordinary course of business dealings. j. Except for transactions authorized under paragraph (f) of these instructions, if a participant in a covered transaction knowingly enters into a lower tier covered transaction with a person who is suspended, debarred, ineligible, orvoluntarily excluded from participation in this transaction, in addition to other remedies available to the Federal Government, the department or agency may terminate this transaction for cause or default. 2. Certification Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion - First Tier Participants: a. The prospective first tier participant certifies to the best of its knowledge and belief, that it and its principals: (1) Are not presently debarred, suspended, proposed for debarment, declared ineligible, or voluntarily excluded from participating in covered transactions by any Federal department or agency; 62 (2) Have not within a three-year period preceding this proposal been convicted of or had a civiljudgment rendered against them for commission of fraud or a criminal offense in connection with obtaining, attempting to obtain, or performing a public (Federal, State or local) transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements, or receiving stolen property; (3) Are not presently indicted for or othenuise criminally or civilly charged by a governmental entity (Federal, State or local) with commission of any of the offenses enumerated in paragraph (a)(2) of this certification; and (4) Have not within a three-year period preceding this application/proposal had one or more public transactions (Federal, State or local) terminated for cause or default. b. Where the prospective participant is unable to certify to any of the statements in this certification, such prospective participant shall attach an explanation to this proposal. 2. Instructions for Certification - Lower Tier Participants: (Applicable to all subcontracts, purchase orders and other lower tier transactions requiring prior FHWA approval or estimated to cost $25,000 or more - 2 cFR Parts 180 and 1200) a. By signing and submitting this proposal, the prospective lower tier is providing the certification set out below. b. The certification in this clause is a material representation of fact upon which reliance was placed when this transaction was entered into. lf it is later determined that the prospective lower tier participant knowingly rendered an erroneous certification, in addition to other remedies available to the Federal Government, the department, or agency with which this transaction originated may pursue available remedies, including suspension andior debarment. c. The prospective lower tier participant shall provide immediate written notice to the person to which this proposal is submitted if at any time the prospective lower tier participant learns that its certification was erroneous by reason of changed circumstances. d. The terms "covered transaction," "debarred," "suspended," "ineligible," "participant," "person," "principal," and "voluntarily excluded," as used in this clause, are defined in 2 CFR Parts 180 and 1200. You may contact the person to which this proposal is submitted for assistance in obtaining a copy of those regulations. "First Tier Covered Transactions" refers to any covered transaction between a grantee or subgrantee of Federal funds and a participant (such as the prime or general contract). "Lower Tier Covered Transactions" refers to any covered transaction under a First Tier Covered Transaction (such as subcontracts). "First Tier Participant" refers to the participant who has entered into a covered transaction with a grantee or subgrantee of Federal funds (such as the prime or general contractor). "Lower Tier Participant" refers any participant who has entered into a covered transaction with a First Tier Participant or other Lower Tier Participants (such as subcontractors and suppliers). e. The prospective lower tier participant agrees by submitting this proposal that, should the proposed covered transaction be entered into, it shall not knowingly enter into any lower tier covered transaction with a person who is debarred, suspended, declared ineligible, or 63 voluntarily excluded from participation in this covered transaction, unless authorized by the department or agency with which this transaction originated- f. The prospective lower tier participant further agrees by submitting this propo_sa.l that it will include this clause titled "Certiflcation Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion-Lower Tier Covered Transaction," without modification, in all lower tier covered iransactions and in all solicitations for lower tier covered transactions exceeding the $25,000 threshold. g. A participant in a covered transaction may rely upon a certification of a prospective participant in a lower tier covered transaction that is not debarred, suspended, ineligible, or voluntarily excluded from the covered transaction, unless it knows that the certification is erroneous. A participant is responsible for ensuring that its principals are not suspended, debarred, or otherwise ineligible to participate in covered transactions. To verify the eligibility of its principals, as well as the eligibility of any lower tier prospective participants, each participant may, but is not required to, check the Excluded Parties List System website (https://wvwv.epls.oov/), which is compiled by the General Services Administration. h. Nothing contained in the foregoing shall be construed to require establishment of a system of records in order to render in good faith the certification required by this clause. The knowledge and information of participant is not required to exceed that which is normally possessed by a prudent person in the ordinary course of business dealings. i. Except for transactions authorized under paragraph e of these instructions, if a participant in a covered transaction knowingly enters into a lower tier covered transaction with a person who is suspended, debarred, ineligible, or voluntarily excluded from participation in this transaction, in addition to other remedies available to the Federal Government, the department or agency with which this transaction originated may pursue available remedies, including suspension andlor debarment. Certification Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion: Lower Tier ParticiPants: 1. The prospective lower tier participant certifies, by submission of this proposal, that neither it nor its piincipals is presently debarred, suspended, proposed for debarment, declared ineligible, or voluntarily excluded from participating in covered transactions by any Federal department or agency. 2. Where the prospective lower tier participant is unable to certify to any of lhe statements in this certification, such prospective participant shall attach an explanation to this proposal. 64 XI. CERTIFICATION REGARDING USE OF CONTRACT FUNDS FOR LOBBYING This provision is applicable to all Federal-aid construction contracts and to all related subcontracts which exceed $100,000 (49 CFR 20). 1. The prospective participant certifies, by signing and submitting this bid or proposal, to the best of his or her knowledge and belief, that: a. No Federal appropriated funds have been paid or will be paid, by or on behalf of the undersigned, to any person for influencing or attempting to influence an officer or employee of any Federal agency, a Member of congress, an officer or employee of congress, or an employee of a Member of Congress in connection with the awarding of any Federal contract, the making of any Federal grant, the making of any Federal loan, the entering into of any cooperative agreement, and the extension, continuation, renewal, amendment, or modification of any Federal contract, grant, loan, or cooperative agreement. b. lf any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any Federal agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with this Federal contract, grant, loan, or cooperative agreement, the undersigned shall complete and submit Standard Form-LLL, "Disclosure Form to Report Lobbying," in accordance with its instructions. 2. This certification is a material representation of fact upon which reliance was placed when this transaction was made or entered into. Submission of this certification is a prerequisite for making or entering into this transaction imposed by 31 U.S.C. 1352. Any person who fails to file the required certification shall be subject to a civil penalty of not less than $10,000 and not more than $100,000 for each such failure. 3. The prospective participant also agrees by submitting its bid or proposal that the participant shall require that the language of this certification be included in all lower tier subcontracts, which exceed $100,000 and that all such recipients shall certify and disclose accordingly. 65 ATTACHMENT A - EMPLOYMENT AND MATERIALS PREFERENCE FOR APPALACHIAN DEVELOPMENT HIGHWAY SYSTEM OR APPALACHIAN LOCAL ACCESS ROAD CONTRACTS This provision is applicable to all Federal-aid projects funded under the Appalachian Regional Development Act of 1965. 1. During the performance of this contract, the contractor undertaking to do work which is, or reasonabiy may be, done as on-site work, shall give preference to qualified persons who regularly reside in the labor area as designated by the DOL wherein the contract work is situated, or the subregion, or the Appalachian counties of the State wherein the contract work is situated, except: a. To the extent that qualified persons regularly residing in the area are not available. b. For the reasonable needs of the contractor to employ supervisory or specially experienced personnel necessary to assure an efficient execution of the contract work. c. For the obligation of the contractor to offer employment to present or former employees as the result of a lawful collective bargaining contract, provided that the number of nonresident persons employed under this subparagraph (1c) shall not exceed 20 percent of the total number of employees employed by the contractor on the contract work, except as provided in subparagraph (4) below. 2. The contractor shall place a job order with the State Employment Service indicating (a) the classifications of the laborers, mechanics and other employees required to perform the contract work, (b) the number of employees required in each classification, (c) the date on which the participant estimates such employees will be required, and (d) any other pertinent information iequired by the State Employment Service to complete the job order form. The job order may be placed with the State Employment Service in writing or by telephone. lf during the course of the contract work, the information submitted by the contractor in the original job order is substantially modified, the participant shall promptly notify the State Employment Service. 3. The contractor shall give full consideration to all qualifled job applicants referred to him by the State Employment Service. The contractor is not required to grant employment to any job applicants who, in his opinion, are not qualified to perform the classification of work required. 4. lf, within one week following the placing of a job order by the contractor with the State Employment Service, the State Employment Service is unable to refer any qualified job applicants to the contractor, or less than the number requested, the State Employment Service wili fonvard a certificate to the contractor indicating the unavailability of applicants. Such certificate shall be made a part of the contractor's permanent project records. Upon receipt of this certificate, the contractor may employ persons who do not normally reside in the labor area to fill positions covered by the certificate, notwithstanding the provisions of subparagraph (1c) above. S.The provisions of 23 CFR 633.207(e) allow the contracting agency to provide a contractual preference for the use of mineral resource materials native to the Appalachian region. 6. The contractor shall include the provisions of Sections 1 through 4 of this Attachment A in every subcontract for work which is, or reasonably may be, done as on-site work' 66 AMENDIT,IENT REQUIRED CONTRACT PROVISIONS (Exclusive of Appalachian Contracts) FEDERAL-AID CONSTRUCTION CONTRACTS The Federal-Aid provisions are supplemented with the following: Xll. Cargo Preference Act 1. U.S. Department of Transportation Federal Highway Administration memorandum dated December 11, 2015 requires that all federal-aid highway programs awarded after February 15, 2016 must comply with the Cargo Preference Act and its regulation of 46 CFR 381.7 (a)-(b). Amendment to Form FHWA 1273 Revised Ja nua ry 25, 2Ot6 67 Proposatfor lncorporating Recycled Materials into the Proiect ln compliance with a new law that went into effect January 1,2A16 (SH81695), the Bidder shall propose below, the total percent of construction aggregate and concrete materials to be incorporated into the Project that are recycled materials. Calculated percentages must be within the amounts allowed in Section 9-03.21(1)E, Table on Maximum Allowable Percent (By Weight) of Recycled Material, of the Standard Specifications. Proposed total percentage:q percent. Nofe; Use of recycled materials is highly encouraged within the limits shown above, but does not constitute a Bidder Preference, and witt not affect the determination of award, unless two or more lowest responsive Bid totats are exactly equal, in which case proposed recycling percentages wili be used as a tie-breaker, per the APWA GSP in Section 1-03.1 of the Special'Provisiois. Regardless, the Bidder's stated proposed percentages will become a goalthe Contractor snoiru do rfs besf to accomplish. Bidders will be required to report on recycled materials actuatty incorporated into the Project, in accordance with the APWA GSP in Section 1-06.6 of the SpecialProvisions. Bidder: Signature of Authorized Official: Date: f.lX- I D+7,1.o>\ 68 This chanqe order form is for examole purooses onlv. Bv submittins a bid, the bidder aorees to be bound bv the terms of this chanqe order form for anv chanoe orders. CHANGE ORDER NO. [Enter # lt 2, 3, etc.] NAME OF CONTRACTOR:[Inseft Comoany Namel ("Contractor") CONTRACT NAME & PROJECT NUMBER: [Inseft Name of Orioinal Contract & Project #. if applicable] ORIGINAL CONTMCT DATE:[Insert Date Orioinal Contract was Sionedl This Change Order amends the above-referenced contracQ all other provisions of the contract that are not inconsistent with this Change Order shall remain in effect. For valuable consideration and by mutual consent of the parties, the project contract is modified as follows: 1. Section 1 of the Contract is hereby modified to revise existing work as follows: In addition to work required under the original Agreement and any prior Amendments, Contractor shall provide all labor, materials, and equipment necessary to: [Insert detailed description of additional"materials, seruices, etc., that are needed which necessitate this change order - Be as detailed as possible. You may also refer to an attached exhibit, but clearly identify the exhibit by title and datel The contract amount and time for performance provisions of Section 1 of the Contract are also modified as follows: Original Contract Sum, (including applicable alternates and wssr) $ Net Change by Previous Change Orders (incl. applicable WSST) $ Cu rrent Contract Amou nt (incl. Previous Change Orderc) $ Current Change Order $ Applicable WSST Tax on this Change Order $ Revised Contract Sum $ 2 212th St, Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 69 March 22,2OZL Original Time for Completion (insert date) Revised Time for Completion under prior Change Orders (insert date) Days Required (+) for this Change Order working days Revised Time for ComPletion (insert date) In accordance with Sections 1-04.4 and 1-04.5 of the Kent Special Provisions and WSDOT Standard Specifications, and Section VII of the Agreement, the Contractor accepts all requirements of this Change Order by signing below. Also, pursuant to the above-referenced contract, Contractor agrees to waive any protest it may have regarding this Change Order and acknowledges and acclpts that this Change Order constitutes final settlement of all claims of any kind or nature arising from or connected with any work either covered or affected by this Change Order, including, without limitation, claims related to contract time, contract acceleration, onsite or home office overhead, or lost profits. This Change Order, unless otherwise provided, does not relieve the Contractor from strict compliance with the guarantee and warranty provisions of the original contract, pafticularly those peftaining to substantial completion date. All acts consistent with the authority of the Agreement, previous Change Orders (if any), and this Change Order, prior to the effective date of this Change Order, are hereby ratified and affirmed, and the terms of the Agreement, previous Change Orders (if any), and this Change Order shall be deemed to have applied. The parties whose names appear below swear under penalty of perjury that they are authorized to enter into this contract modification, which is binding on the parties of this contract. 3. The Contractor will adjust the amount of its performance bond (if any) for this project to be consistent with the revised contract sum shown in section 2, above. IN WITNESS, the pafties below have executed this Agreement, which will become effective on the last date written below. 21zth St. Preservation/Holcomb Federal Aid Number: STPUL-f250(009) Project Number: 19-3003 CONTRACTOR: By (signature) Print Name (title) DATEI CITY OF KENT: Rrr. (tlSrrtrA Print Name: Chad Bieren, P.E. Its Public Works Director (tiue) DATE APPROVED AS TO FORMI (applicable if Mayor's signaturc reguired) Kent Law Depaftment 70 March 22,2021 s BIDDER'S CHECKLIST The following checklist is a guideline to help the Contractor make sure all forms are complete. The bidder's attention is especially called to the following forms. Failure to execute these forms as required may result in rejection of any bid. Bidder's Package should include the following: Bid Document Cover Sheet filled out with Bidder's Name ......... tr Bid Document Contents ......... tr Invitation to Bid........ ........,.... tr Information for Bidders......................:........ ............. tr Contractor Compliance Statement. ........,. trDate.......... .........,....,.... tr Have/have not participated acknowledgment Signature and address..,............ ............,...... tr Declaration - City of Kent Equal Employment Opportunity Policy ............... tr Date and signature .......tr First line of proposal - filled in Unit prices are correct..tr Proposal Signature Pa9e......... ................ tr All Addenda acknowledged......... ................... tr Date, signature and address ......... tr Bid Bond Form ........ .............. tr Signature, sealed and dated ......... tr Power of Attorney... (Amount of bid boni shall equal 5o/o ot the total bid amount) Contractor's Qual ification Statement Statement that Bidder Has Not Been Disqualified Certification of Compliance with Wage Payment Statutes Subcontractor List (contracts over glM - HVAC, Ptumbing, & Electrical)..................... tr Subcontractors listed properly.... ................... trSignature ,...........,....... tr subcontractor List (contracts over $lM - structural steel & Rebar Installation)......... tr Subcontractors listed properly.... Date and signature Local Agency Subcontractor List ............ Combined Declaration Form ....,.... Signature Non-Collusion Declaration.... Local Agency Certification for Federal-Aid Contracts Disadvantaged Business Enterprise (DBE) Bid ltem Breakdown Form Disadvantaged Business Enterprise UtilizationCertification............... .......,.... tr Disadvantaged Business Enterprise (DBE) Trucking Credit Form......... .....,. tr Disadvantaged Business Enterprise Written Confirmation Document..,............ ........... tr Required Contract Provisions Federal-Aid Construction Contracts .............. tr Proposal for Incorporating Recycling Materials into the Project tr tr tr tr tr tr tr Change Order Form tr tr trBidder's Checklist The following forms are to be executed after the Contract is awarded:A) CONTMCT This agreement is to be executed by the successful bidder.B) PAYMENTAND PERFORMANCE BOND To be executed by the successful bidder and its surety company. The following form is to be executed after the Contract is completed:A) CITY OF KENT EOUAL EMPLOYMENT OPPORTUNITY COMPLIANCE STATEMENT To be executed by the successful bidder AFTER COMPLETION of this contract. 212th St, Preservation/Holcomb 7t March 22,2OZL Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 CONTRACT DOCUMENTS CONTENTS Contract............................................................................................. 73 Performance Bond (272-002A)............................................................... 76 Payment Bond (272-003A).................................................................... 77 212th St. Preservation/Holcomb 72 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 CONTRACT THIS AGREEMENT, is entered i to between the CIry OF KENT, a Washington municipal corporation ("City"), and ,?t tN organized u business at nder the laws of the State of A ?L60' fi- 56 H , located and doing ("Contractor").?c,t-v-, 1 WITN ESS: In consideration of the terms and conditions contained in this Agreement and in the project documents, plans, and specifications all of which are a part of this Agreement, the parties agree as follows: The Contractor shall do all work and furnish all tools, materials, and equipment for: S. 2L2th St. Preservation 72nd Ave. S. to 84th Ave. S. (EastValley Highway)/Federal Aid Number: STPUL-125O(OO9)/Project Number: 19- 3OO3 in accordance with and as described in the Contract and shall perform any alterations in or additions to the work provided under the Contract and every part thereof, The Contract shall include all project specifications, provisions, and plans; the City's general and special conditions; the 2O2L Standard Specifications for Road, Bridge, and Municipal Construction, as prepared by the Washington State Department of Transportation and the Washington State Chapter of the American Public Works Association, including all published amendments issued by those organizations, if applicable ("standard Specifications"); the City's bid documents; and the Contractor's response to the City's bid. The Contractor is responsible to obtain copies of the 2O2L WSDOT Standard Specifications including the latest amendments issued by WSDOT as of the date of bid opening. Unless otherwise directed by the City, work shall start within ten (10) days after the City issues its Notice to Proceed and work shall be physically completed within seventy (7O) working days. The term of this Contract shall continue until all work has been completed, Final Acceptance has occurred, and all Contractor obligations have been fulfilled. The Contractor shall provide and bear all expense of all equipment, work, and labor of any sort whatsoever that may be required for the transfer of materials and for constructing and completing all the work provided for in the Contract, except where the specifications allocate that responsibility to the City, The total contract amount for all Work performed under this Contract, including Washington State Sales Tax, is $1,859,868.10, 2. The City hereby promises and agrees with the Contractor to employ, and does employ, the Contractor to provide the materials and to do and cause to be done the above described work and to complete and finish the same according to the Contract and the terms and conditions herein contained and hereby contracts to pay for the same according to the Contract and the schedule of unit or itemized prices provided by Contractor in its response to the City's bid, at the time and in the manner and upon the conditions provided for in the Contract. 3. The Contractor for itself, and for its heirs, executors, administrators, successors, and assigns, does hereby agree to the full performance of all covenants herein contained upon the part of the Contractor, 212th St. Preservation/Holcomb 73 April 13, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 4 5 It is further provided that no liability shall attach to the City by reason of entering into this contract, except as expressly provided herein. Contractor shall defend, indemnify, and hold the City, its officers, officials, employees, agents, volunteers and assigns harmless from any and all claims, injuries, damages, losses or suits, including all legal costs and attorney fees, arising out of or in connection with the performance of this contract, except for injuries and damages caused by the sole negligence of the City. The City's inspection or acceptance of any of Contractor's work when completed shall not be grounds to avoid any of these covenants of indemnification. Should a court of competent jurisdiction determine that this contract is subject to RCW 4.24.115, then, in the event of liability for damages arising out of bodily injury to persons or damages to property caused by or resulting from the concurrent negligence of the Contractor and the City, its officers, officials, employees, agents and volunteers, the Contractor's liability hereunder shall be only to the extent of the Contractor's negligence. IT IS FURTHER SPECIFICALLY AND EXPRESSLY UNDERSTOOD THAT THE INDEMNIFICATION PROVIDED HEREIN CONSTITUTES THE CONTRACTOR'S WAIVER OF IMMUNIry UNDER INDUSTRIAL INSURANCE, TITLE 51 RCW, SOLELY FOR THE PURPOSES OF THIS INDEMNIFICATION. THE PARTIES FURTHER ACKNOWLEDGE THAT THEY HAVE MUTUALLY NEGOTIATED THIS WAIVER. The provisions of this section shall survive the expiration or termination of this contract. Contractor agrees, upon the City's written demand, to make all books and records available to the City for inspection, review, photocopying, and audit in the event of a contract related dispute, claim, modification, or other contract related action at reasonable times (not to exceed three (3) business days) and at places designated by the City. The Contractor shall procure and maintain, during the term of construction and throughout the specified term of maintenance, insurance of the types and in the amounts described in Section L-07.18 attached and incorporated by this reference, Contractor is responsible for locating any underground utilities affected by the work and is deemed to be an excavator for purposes of RCW Ch, 19.122, as amended. Contractor shall be responsible for compliance with RCW Ch. 19.I22, including utilization of the "one call" locator service before commencing any excavation activities. 6 7 8 2 12th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 74 March 22,202L CITY OF KENT BY DANA RALPH, MAYOR DATE: ATTEST: KIMBERLEY A, KOMOTO, CIry CLERK APPROVED AS TO FORM: KENT LAW DEPARTMENT CONTRACTOR BY: PRINT TITLE: DATE:L8 212th St. Preservation/Holcomb Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 E 75 March 22,202L 05/06/2021 1 of 22 (TLJ01) CERTIFICATE HOLDER © 1988-2010 ACORD CORPORATION. All rights reserved. ACORD 25 (2010/05) AUTHORIZED REPRESENTATIVE CANCELLATION DATE (MM/DD/YYYY)CERTIFICATE OF LIABILITY INSURANCE LOCJECTPRO-POLICY GEN'L AGGREGATE LIMIT APPLIES PER: OCCURCLAIMS-MADE COMMERCIAL GENERAL LIABILITY GENERAL LIABILITY PREMISES (Ea occurrence)$DAMAGE TO RENTED EACH OCCURRENCE $ MED EXP (Any one person) $ PERSONAL & ADV INJURY $ GENERAL AGGREGATE $ PRODUCTS - COMP/OP AGG $ $RETENTIONDED CLAIMS-MADE OCCUR $ AGGREGATE $ EACH OCCURRENCE $ UMBRELLA LIAB EXCESS LIAB DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (Attach ACORD 101, Additional Remarks Schedule, if more space is required) INSRLTR TYPE OF INSURANCE POLICY NUMBER POLICY EFF(MM/DD/YYYY)POLICY EXP(MM/DD/YYYY)LIMITS WC STATU-TORY LIMITS OTH-ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE E.L. DISEASE - POLICY LIMIT $ $ $ ANY PROPRIETOR/PARTNER/EXECUTIVE If yes, describe underDESCRIPTION OF OPERATIONS below (Mandatory in NH) OFFICER/MEMBER EXCLUDED? WORKERS COMPENSATION AND EMPLOYERS' LIABILITY Y / N AUTOMOBILE LIABILITY ANY AUTO ALL OWNED SCHEDULED HIRED AUTOS NON-OWNEDAUTOSAUTOS AUTOS COMBINED SINGLE LIMIT BODILY INJURY (Per person) BODILY INJURY (Per accident) PROPERTY DAMAGE $ $ $ $ THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. INSR ADDL WVD SUBR N / A $ $ (Ea accident) (Per accident) THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). The ACORD name and logo are registered marks of ACORD COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: INSURED PHONE(A/C, No, Ext): PRODUCER ADDRESS:E-MAIL FAX(A/C, No): CONTACTNAME: NAIC # INSURER A : INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : INSURER(S) AFFORDING COVERAGE SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. 05/03/2021 Parker, Smith & Feek, Inc. 2233 112th Avenue NE Bellevue, WA 98004 425-709-3600 425-709-7460 Zurich American Insurance Co. Lakeside Industries, Inc. P.O. Box 7016 Issaquah, WA 98027 American Guarantee & Liability Ins. Indian Harbor Insurance Company A X 2,000,000 8 X 8 8 8 GLO043012500 06/01/2020 06/01/2021 300,000 10,000 2,000,000 4,000,000 4,000,000 A 2,000,000 8 X X BAP044927100 06/01/2020 06/01/2021 B 8 10,000,000 8 X X 10,000,000 8 0 SXS937923716 06/01/2020 06/01/2021 A 806/01/2020 06/01/2021 1,000,000 GLO043012500 ** WA Stop Gap 1,000,000 1,000,000 C Combined Pollution / Professional Liability X CEO744692604 06/01/2020 X 06/01/2021 $5,000,000 Occurence $10,000,000 Aggregate S 212th St Preservation 72nd Ave S to 84th Ave S (East Valley Hwy) Project Number 19-3003... (See Attached Description) City of Kent Public Works Department 400 West Gowe Kent, WA 98032 2 of 22 (TLJ01) DESCRIPTIONS (Continued from Page ) 1 City of Kent Public Works Department and City of Kent, Union Pacific RR Company Property, BNSF Railway Company Property are additional insureds on the general liability, automobile, and excess liability policies per the attached endorsements/forms. Coverage is primary and non-contributory on the general liability, automobile, and excess liability policies per the attached endorsements/forms. Waiver of subrogation applies on the general liability, automobile, and excess liability policies per the attached endorsements/forms. CANCELS AND REPLACES PREVIOUSLY ISSUED CERTIFICATE. 3 of 22 (TLJ01) Contracting Activity(ies) E. means any general construction activity performed by or on behalf of the Named Insured Design Professional F. Design Professional's Insurance G. Design Professional Services H. means any person or entity that is legally qualified, certified or licensed to perform services which are covered by Design Professional's Insurance, including subcontractors and subconsultants at any tier. means all architects and engineers, or contractors professional liability insurance policies which insure a Design Professional. means services lhat any Design Professional: 1. agreed to perform pursuanl to a written contract with the Insured; 2. which are included within the Professional Activities and Duties that the Insured agreed to perform in a written contract; and 3. which are covered by Design Professional's Insurance. Emergency Remediation I. Expense means direct costs and expenses that we deem necessary to mitigate on an emergency basis the immediate effects of a Pollution Condition at a Job Site resulting from the rendering or failure to render Contracting Activities, Environmental Damage J. Insured K. means physical damage in or upon land, the atmosphere, watercourse, body of water or groundwater, caused by a Pollution Condition and resulting in Remediation Expense. means each of the following: 1. the Named Insured; 2. your current or former directors, partners, principals, members, executive officers, stockholders, or trustees, but solely within the course and scope of their duties as such; 3. your current or former employees including leased personnel under your supervision, but solely within the course and scope of their employment or lease agreement; 4. your heirs, executors, administrators, assigns or legal representatives in the event of death, incapacity or bankruptcy, but only with respect to the liability ofthe Named Insured otherwise insured herein; 5. any Predecessor in Interest; 6. any entity that is newly formed or acquired by you during the Policy Period where you have greater than fifty percent (50%) ownership, control, or beneficial interest, provided however thaL a. coverage shall be provided only for Professional Loss arising out of Professional Activities and Duties and/or Pollution Loss arising from Contracting Activity performed on or after the date of formation or acquisition, subject to the Retroactive Date; and KLD 051 0113 © 2013 X.L. America. Inc. All Righis Reserved. May not be copied without permission. Page 5 of 25 4 of 22 (TLJ01) b. this coverage shall expire at the end of the Policy Period or wilhin ninety (90) days of such formation or acquisition of the entity, whichever is eariier, unless you submit written notice to us providing detailed information concerning the newly formed or acquired enlily, confirmed by us by endorsement, and provided that you pay any applicable additional premium requested by us; 7. Any Insured with regard to its participation in a legal entity including a limited liability company or joint venture, but only lothe extent of the Insured's legal liabilily for its rendering of Professional Activities and Duties and/or Contracting Activities underthe respective legal entity or joint venture; 8. With regard to Section 1; What We Cover D.I., the Client, but only: a, if the you are required lo include the Client as an additional Insured in a written coniract in effect during the Policy Period and signed by the you prior lo the first commencement of the Pollution Condition; and b. with respect lo the Client's vicarious liability resulting from your Contracting Activity. 9. With regard to Section 1: What We Cover D. 1., all persons or organizations, other than a Client, as required by a written coniract executed by the Named Insured, but only for: a. a Pollution Condition caused by your Contracting Activity; and b. the vicarious liability of the person or organization that results from the performance of your Contracting Activity provided that such written contract is signed by the Named Insured prior to the commencement ofthe Pollution Condition. Insured Contract L. means that part of any written contract or written agreement under which you assume the Tort Liability of another party to pay compensatory damages for Bodily Injury or Property Damage, to a third person or organization, provided that such written contract or written agreement is signed by you prior to the Bodily Injury or Property Damage. Tort Liabiiity means a liability that would be imposed by law in the absence of any contract or agreement. KLD 051 0113 © 2013 X.L. America. Inc. Page 6 of 25 All Rights Reserved May not be copied without permission. 5 of 22 (TLJ01) Declarations and G. Representations By acceptance of this policy, you agree that the statements and Information contained in the Application and other supplemental materials submitted to us are: (a) true and correct; (b) such statements and information are material to our underwriting ofthis policy; and (c) that this policy has been issued by us in reliance upon the truth and correctness of such statements and information. Design Professional's Insurance H. The Insured shall require that each Design Professional under written contract to it evidence professional liability insurance. Headings Inspection and Audit J. The descriptions in the headings of this policy are solely for convenience and form no part of the terms and conditions of this policy. We will be permitted, but nol obligated, to examine, audit, monitor and inspect on a continuing basis any ofthe Insured's books, records, services, properties and activities at any time, as far as they relate to the subject matter of this policy. Neither our right to examine, audit, monitor and make inspections, or the actual undertaking thereof or any report thereon, neither constitutes an undertaking to determine or warrant that property or operations are safe, healthful or conform to acceptable engineering practice or are in compliance with any law, rule or regulation. Any inspections will be coordinated through your broker or agent. We may modify, amend or delete any of the terms and conditions of this policy including the right to charge additional premium and the right to cancel, rescind or void this policy, if our examination, audit, monitoring or inspection reveals any material risk, hazard or condition that was not previously disclosed by any Insured in the Application or supplemental materials, or which deviates from the information disclosed in the Application or supplemental materials. Limitation of Liability K. Under Protective Loss Coverage, the Insured shall not accept any limitation of liability from a Design Professional other than to insurance proceeds, without our express written consent. Other Insurance L. Where other valid and collectible insurance is available to the Insured, in addition to Design Professional's Insurance, our obligations to the Insured are as follows: 1. This insurance is excess over any other valid and collectible insurance, whether such other insurance is stated to be primary, contributory, excess, contingent or otherwise. 2. This insurance is excess over any olher valid and collectible insurance available lo the Insured under a project specific insurance policy, contractor-controlled insurance program, owner- controlled insurance program, consolidated (wrap-up) insurance program or any other similar insurance or program, whether such other insurance or program is stated to be primary, contributory, excess, contingent or othei^ise. 3. This insurance is excess over any other valid and collectible Design Professional's Insurance whether such other insurance is stated lo be primary, contributory, excess, contingent or otherwise. KLD 051 0113 © 2013 X L. America, Inc All Rights Reserved. May not be copied without permission. Page 24 of 25 6 of 22 (TLJ01) Under Section 1: What We Cover: D. Pollution Loss Coverage only, when the Named Insured is required by contract, agreement, or permit to include any person or entity as an additional insured, such coverage shall be provided on a primary and non-contributory basis. Severability M. Sole Agent N. Except with respect to the Limits of Liabilily and the Self-Insured Retention Amount, and any rights or duties specifically assigned in this policy to you, this insurance applies: (a) as if each Named Insured were the only Named Insured; and (b) separately to each Insured against or by whom a Claim is made. Misrepresentation, concealment, breach of condition or violation of any duty under this policy by one Insured shall not prejudice the Interest or coverage of another Insured under this policy. You will act on behalf of all Insured(s) for the payment or return of premium, receipt and acceptance of any endorsement issued to form a part of this policy, giving and receiving notice of cancellation or non- renewal and the exercise ofthe righis provided in Section 6: Exlended Reporting Period, B. Optional Exlended Reporting Period. Subrogation O. In the evenl of any payment underthis policy, we will be subrogated to all ofthe Insured's rights of recovery against any person or organization and the Insured will execute and deliver instruments and papers and do whatever else is necessary to secure such rights. The Insured will do nothing at any time to prejudice our subrogation rights. However, we waive our right(s) of recovery against any person or organization included in the definition of an Insured or against the Insured's Clients, if prior to a Professional Liability Claim, a waiver of subrogation was so required and accepted under a specific contractual undertaking by the Insured. Under Section 1: What We Cover: D, Pollution Loss Coverage, we waive our right(s) of recovery against any person or organization included in the definition of an Insured or against the Insured's Clients if prior to the Pollution Claim, a waiver of subrogation was required and accepted under a specific contraciual undertaking by the Insured. Territory P. Coverage granted under this policy will apply anywhere in the worid, to the extent permitted by law. KLD 051 0113 ©2013X,L. America, Inc. All Rights Reserved. May not be copied without permission. Page 25 of 25 7 of 22 (TLJ01) Under Section 1: What We Cover: D. Pollution Loss Coverage only, when the Named Insured is required by contract, agreement, or permit to include any person or entity as an additional insured, such coverage shall be provided on a primary and non-contributory basis. Severability M. Sole Agent N. Except with respect to the Limits of Liabilily and the Self-Insured Retention Amount, and any rights or duties specifically assigned in this policy to you, this insurance applies: (a) as if each Named Insured were the only Named Insured; and (b) separately to each Insured against or by whom a Claim is made. Misrepresentation, concealment, breach of condition or violation of any duty under this policy by one Insured shall not prejudice the Interest or coverage of another Insured under this policy. You will act on behalf of all Insured(s) for the payment or return of premium, receipt and acceptance of any endorsement issued to form a part of this policy, giving and receiving notice of cancellation or non- renewal and the exercise ofthe righis provided in Section 6: Exlended Reporting Period, B. Optional Exlended Reporting Period. Subrogation O. In the evenl of any payment underthis policy, we will be subrogated to all ofthe Insured's rights of recovery against any person or organization and the Insured will execute and deliver instruments and papers and do whatever else is necessary to secure such rights. The Insured will do nothing at any time to prejudice our subrogation rights. However, we waive our right(s) of recovery against any person or organization included in the definition of an Insured or against the Insured's Clients, if prior to a Professional Liability Claim, a waiver of subrogation was so required and accepted under a specific contractual undertaking by the Insured. Under Section 1: What We Cover: D, Pollution Loss Coverage, we waive our right(s) of recovery against any person or organization included in the definition of an Insured or against the Insured's Clients if prior to the Pollution Claim, a waiver of subrogation was required and accepted under a specific contraciual undertaking by the Insured. Territory P. Coverage granted under this policy will apply anywhere in the worid, to the extent permitted by law. KLD 051 0113 ©2013X,L. America, Inc. All Rights Reserved. May not be copied without permission. Page 25 of 25 8 of 22 (TLJ01) Additional Insured - Automatic - Owners, Lessees Or ZURICH Contractors THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0430125-00 Effective Date: 06/01/2020 This endorsement modifies insurance provided under the: Commercial General Liability Coverage Part A. Section II - Who Is An Insured is amended to include as an additional insured any person or organization whom you are required to add as an additional insured under a written contract or written agreement executed by you, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" and subject to the following: 1. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (10/01 edition); or b. The ISO CG 20 37 (10/01 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" arises out of: (1) Your ongoing operations, with respect to Paragraph l.a. above; or (2) "Yourwork", with respectto Paragraph l.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 1., insurance afforded to such additional insured: (a) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy penod and subsequent to your execution of the written contract or written agreement; and (b) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. 2. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (07/04 edition); or b. The ISO CG 20 37 (07/04 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part, by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf. U-GL-2162-A CW (02/19) Page 1 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 9 of 22 (TLJ01) in the performance of; (a) Your ongoing operations, with respect to Paragraph 2.a. above; or (b) "Your work" and included in the "products-completed operations hazard", with respect to Paragraph 2.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 2., insurance afforded to such additional insured: (i) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or wntten agreement; and (ii) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 10 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to ongoing operations (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf, in the performance of your ongoing operations, which is the subjecl of the written contract or written agreement. However, solely with respect to this Paragraph 3., insurance afforded to such additional insured: (a) Only applies to the extent permitted by law; (b) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; and (c) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 37 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to the "products-completed operations hazard" (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury" or "property damage" is caused, in whole or in part by "your work" and included in the "products-completed operations hazard", which is the subject of the wntten contract or written agreement. However, solely with respect to this Paragraph 4., insurance afforded to such additional insured: (1) Only applies to the extent permitted by law; (2) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; (3) Only applies if the "bodily injury" or "property damage" occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (4) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. U-GL-2162-A CW (02/19) Page 2 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 10 of 22 (TLJ01) B. Solely with respect to the insurance afforded to any additional insured referenced in Section A. of this endorsement, the following additional exclusion applies: This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services including: 1. The preparing, approving or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or 2. Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional architectural, engineering or surveying services. C. Solely with respect to the coverage provided by this endorsement, the following is added to Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim Or Suit of Section IV - Commercial General Liability Conditions: The additional insured must see to it that: (1) We are notified as soon as practicable of an "occurrence" or offense that may result in a claim; (2) We receive written notice of a claim or "suit" as soon as practicable; and (3) A request for defense and indemnity of the claim or "suit" will promptly be brought against any policy issued by another insurer under which the additional insured may be an insured in any capacity. This provision does not apply to insurance on which the additional insured is a Named Insured if the written contract or written agreement requires that this coverage be primary and non-contributory. D. Solely with respect to the coverage provided by this endorsement: 1. The following is added to the Other Insurance Condition of Section IV - Commercial General Liability Conditions: Primary and Noncontributory insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured provided that: a. The additional insured is a Named Insured under such other insurance; and b. You are required by written contract or written agreement that this insurance be primary and not seek contribution from any other insurance available to the additional insured. 2. The following paragraph is added to Paragraph 4.b. of the Other Insurance Condition under Section iV - Commercial General Liability Conditions: This insurance is excess over: Any of the other insurance, whether primary, excess, contingent or on any other basis, available to an additional insured, in which the additional insured on our policy is also covered as an additional insured on another policy providing coverage for the same "occurrence", offense, claim or "suit". This provision does not apply to any policy in which the additional insured is a Named Insured on such other policy and where our policy is required by a wntten contract or written agreement to provide coverage to the additional insured on a primary and non- conthbutory basis. E. This endorsement does not apply to an additional insured which has been added to this Coverage Part by an endorsement showing the additional insured in a Schedule of additional insureds, and which endorsement applies specifically to that identified additional insured. F. Solely with respect to the insurance afforded to an additional insured under Paragraph A.3. or Paragraph A.4. of this endorsement, the following is added to Section III - Limits Of Insurance: Additional Insured - Automatic - Owners, Lessees Or Contractors Limit The most we will pay on behalf of the additional insured is the amount of insurance: U-GL-2162-A CW (02/19) Page 3 of 4 Includes copyhghted malerial of Insurance Services Office. Inc.. with its permission. 11 of 22 (TLJ01) 1. Required by the written contract or written agreement referenced in Section A. of this endorsement; or 2. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This endorsement shall not increase the applicable Limits of Insurance shown in the Declarations. All other terms, conditions, provisions and exclusions of this policy remain the same. U-GL-2162-A CW (02/19) Page 4 of 4 Includes copyrighted material of Insurance Services Office, Inc , with its permission. 12 of 22 (TLJ01) GLO043012500 06/01/2020 06/01/2021 06/01/2020 13 of 22 (TLJ01)2 of 14 BNBUINC (SMV01) THIS PAGE INTENTIONALLY LEFT BLANK 14 of 22 (TLJ01) CG 24 17 10 01 © ISO Properties, Inc., 2000 Page 1 of 1 POLICY NUMBER: COMMERCIAL GENERAL LIABILITY CG 24 17 10 01 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CONTRACTUAL LIABILITY – RAILROADS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SCHEDULE Scheduled Railroad: Designated Job Site: All work where required by written contract or agreement executed prior to loss, and that contract specifically requires amendment for construction or demolition work within 50 ft. of the railroad. (If no entry appears above, information required to complete this endorsement will be shown in the Declarations as applicable to this endorsement.) With respect to operations performed for, or affecting, a Scheduled Railroad at a Designated Job Site, the definition of "insured contract" in the Definitions sec- tion is replaced by the following: 9."Insured Contract" means: a.A contract for a lease of premises. However, that portion of the contract for a lease of premises that indemnifies any person or or- ganization for damage by fire to premises while rented to you or temporarily occupied by you with permission of the owner is not an "insured contract"; b.A sidetrack agreement; c.Any easement or license agreement; d.An obligation, as required by ordinance, to indemnify a municipality, except in connection with work for a municipality; e.An elevator maintenance agreement; f.That part of any other contract or agreement pertaining to your business (including an in- demnification of a municipality in connection with work performed for a municipality) under which you assume the tort liability of another party to pay for "bodily injury" or "property damage" to a third person or organization. Tort liability means a liability that would be imposed by law in the absence of any contract or agreement. Paragraph f. does not include that part of any contract or agreement: (1) That indemnifies an architect, engineer or surveyor for injury or damage arising out of: (a) Preparing, approving or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders or draw- ings and specifications; or (b) Giving directions or instructions, or failing to give them, if that is the pri- mary cause of the injury or damage; (2) Under which the insured, if an architect, engineer or surveyor, assumes liability for an injury or damage arising out of the insured's rendering or failure to render professional services, including those listed in Paragraph (1) above and super- visory, inspection, architectural or engi- neering activities. 15 of 22 (TLJ01) BAP044927100 06/01/2020 06/01/2021 06/01/2020 16 of 22 (TLJ01) 17 of 22 (TLJ01) agent, servant or employee of the "insured" to notify us of any "accident", claim, "suit" or "loss" shall not invalidate the insurance afforded by this policy. Include, as soon as practicable: (1) How, when and where the "accident" or "loss" occurred and if a claim is made or "suit" is brought, written notice of the claim or "suit" including, but not limited to, the date and details of such claim or "suit"; (2) The "insured's" name and address; and (3) To the extent possible, the names and addresses of any injured persons and witnesses. If you report an "accident", claim, "suit" or "loss" to another insurer when you should have reported to us, your failure to report to us will not be seen as a violation of these amended duties provided you give us notice as soon as practicable after the fact of the delay becomes known to you. P. Waiver of Transfer Of Rights Of Recovery Against Others To Us The following is added to the Transfer Of Rights Of Recovery Against Others To Us Condition; This Condition does not apply to the extent required of you by a written contract, executed phor to any "accident" or "loss", provided that the "accident" or 'loss" arises out of operations contemplated by such contract. This waiver only applies to the person or organization designated in the contract. Q. Employee Hired Autos - Physical Damage Paragraph b. of the Other Insurance Condition in the Business Auto Coverage Form and Paragraph f. of the Other Insurance - Primary and Excess Insurance Provisions Condition in the Motor Carrier Coverage Form are replaced by the following: For Hired Auto Physical Damage Coverage, the following are deemed to be covered "autos" you own: (1) Any covered "auto" you lease, hire, rent or borrow; and (2) Any covered "auto" hired or rented under a written contract or written agreement entered into by an "employee" or elected or appointed official with your permission while being operated within the course and scope of that "employee's" employment by you or that elected or appointed official's duties as respect their obligations to you. However, any "auto" that is leased, hired, rented or borrowed with a driver is not a covered "auto". R. Unintentional Failure to Disclose Hazards The following is added to the Concealment, Misrepresentation Or Fraud Condition; However, we will not deny coverage under this Coverage Form if you unintentionally: (1) Fail to disclose any hazards existing at the inception date of this Coverage Form; or (2) Make an error, omission, improper description of "autos" or other misstatement of information. You must notify us as soon as possible after the discovery of any hazards or any other information that was not provided to us priorto the acceptance of this policy. S. Hired Auto - World Wide Coverage Paragraph 7a.(5) of the Policy Period, Coverage Territory Condition is replaced by the following: (5) Anywhere in the world if a covered "auto" is leased, hired, rented or borrowed for a period of 60 days or less, T. Bodily Injury Redefined The definition of "bodily injury" In the Definitions Section is replaced by the following: "Bodily injury" means bodily injury, sickness or disease, sustained by a person including death or mental anguish, resulting from any of these at any time. Mental anguish means any type of mental or emotional illness or disease. U-CA-424-F CW (04-14) Page 5 of 6 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 18 of 22 (TLJ01)2 of 14 BNBUINC (SMV01) THIS PAGE INTENTIONALLY LEFT BLANK 19 of 22 (TLJ01) POLICY NUMBER: COMMERCIAL AUTO CA 20 70 10 13 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CA 20 70 10 13 © Insurance Services Office, Inc., 2011 Page 1 of 1 Wolters Kluwer Financial Services | Uniform FormsTM COVERAGE FOR CERTAIN OPERATIONS IN CONNECTION WITH RAILROADS This endorsement modifies insurance provided under the following: AUTO DEALERS COVERAGE FORM BUSINESS AUTO COVERAGE FORM MOTOR CARRIERS COVERAGE FORM With respect to coverage provided under this endorsement, the provisions of the Coverage Form apply unless modified by the endorsement. This endorsement changes the policy effective on the inception date of the policy unless another date is indicated below. Named Insured: Endorsement Effective Date: SCHEDULE Scheduled Railroad Designated Job Site All work where required by written contract or agreement executed prior to loss, and that contract specifically requires amendment for construction or demolition work within 50 ft. of the railroad. Information required to complete this Schedule, if not shown above, will be shown in the Declarations. With respect to the use of a covered "auto" in operations for or affecting a railroad designated in the Schedule at a Designated Job Site, the two exceptions contained in the definition of "insured contract" relating to construction or demolition operations performed within 50 feet of a railroad do not apply. 20 of 22 (TLJ01) straight Excess Liability Policy ZURICH There are provisions in this policy that restrict coverage. Read the entire policy carefully to determine rights, duties and what is and is not covered. Throughout this policy, the words "you" and "your" refer to the Named Insured shown in the Declarations, and any other person or organization qualifying as such in underlying insurance. The words "we", "us" and "our" refer to the company providing this insurance. The word "insured(s)" means any person or organization qualifying as such in underlying insurance but only to the extent and within the scope for which such "insured(s)" qualify for coverage in underlying insurance. Words and phrases that are printed in bold-face type are defined in this policy. These definitions are found in SECTION VI. DEFINITIONS of this policy or in the specific policy provision where they appear. In consideration of the payment of the premium and in reliance upon the statements in the Declarations and in accordance with the provisions ofthis policy, we agree with you to provide coverage as follows: Insuring Agreements SECTION 1. COVERAGE A. We will pay on behalf of the insured those damages covered by this insurance in excess ofthe total Applicable Limits of underlying insurance. This policy Includes: 1. The terms and conditions of underlying insurance to the extent such terms and conditions are not inconsistent or do not conflict with the terms and conditions referred to in Paragraph 2. below; and 2. The terms and conditions that apply to this policy. B. Notwithstanding anything to the contrary contained in Paragraph A. above, if underlying insurance does not apply to damages for reasons other than exhaustion of total applicable limits of insurance by payment of loss, then this policy does not apply to such damages. C. The amount we will pay under this policy is limited as described in SECTION II. LIMITS OF INSURANCE. D. We have no obligation under this policy with respect to any settlement made without our consent. E. The insurance afforded under this policy applies to bodily injury or property damage only if prior to the Policy Period, neither you nor any authorized person knew that the bodily injury or property damage had occurred, in whole or in part. If you or any authorized person knew, prior to the Policy Period, that the bodily injury or property damage occurred, then any continuation, change or resumption of such bodily injury or property damage during or after the Policy Period will be deemed to have been known prior to the Policy Period. Bodily injury or property damage which occurs during the Policy Period and was not, prior to the Policy Period, known to have occurred by you or any authorized person includes any continuation, change or resumption of that bodily injury or property damage after the Policy Period; and Bodily injury or property damage will be deemed to have been known to have occurred at the eariiest time when you or any authorized person: 1. Reports all or any part of, the bodily injury or property damage to us or any other insurer; 2. Receives a written or verbal demand or claim for damages because ofthe bodily injury or property damage; or 3. Becomes aware by any other means that bodily injury or property damage has occurred or has begun to occur. U-SXS-100-A CW (09/11) Pagel of 10 21 of 22 (TLJ01) Limited Other Insurance Condition Amendment Policy No. Eff. Date of Pol. Exp. Date of Pol. Named Insured and Mailing Address: Eff. Date of End. Producer Add'l Prem. Producer: PARKER, SMITH & FEEK, INC. 2233 112TH AVE NE BELLEVUE, WA 98004-2936 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ® ZURICH Return Prem. Condition G. Other Insurance of SECTION V. CONDITIONS, paragraph G., Other Insurance is deleted and replaced with the following: G. Other Insurance If other insurance applies to damages that are also covered by this policy, this policy will apply excess of the other insurance. However, this provision will not apply: 1. If the other insurance is written to be excess of this policy; or 2. If you have agreed in a written contract to carry insurance to apply prior to and be non-contributory with that of another person or organization's insurance, but only as respects damages arising out of insured operations or work on your behalf performed under such written contract. However, the limits available to the othe r person or organization will be the lesser of our policy Limits of Insurance or the limits required by such written contract. In that case, other insurance of that person or organization will apply as excess and not contribute prior to the insurance afforded by this policy. Nothing herein will be construed to make this policy subject to the terms, conditions and limitations of such other insurance. ALL OTHER TERMS AND CONDITIONS OF THIS POLICY REMAIN UNCHANGED. Includes copyrighted material of Insurance Services Office, Inc., with its permission. U-EXS-420-A CW (03/12) Page 1 of 1 22 of 22 (TLJ01) I. Transfer of Rights of Recovery Against Others to Us 1. Ifthe insured has rights to recover att or part ofany payment we have made underthis insurance, those rights are transferred to us. The insured must do nothing after the loss to impair them. At our request, the insured will bring suit or transfer those rights to us and help us enforce them. However, if any insured is required to waive their rights of recovery from others by a written contract or agreement executed before a loss, we agree to waive our rights of recovery to the extent required by the written contract or agreement This waiver of rights will not be construed to be a waiver with respect to any other operations for which the insured has not waived their rights of recovery by contract. 2. Any amount recovered will be apportioned in the inverse order of payment of loss to the extent of actual payment. The expenses of atl such recovery proceedings will be apportioned in the ratio of respective recoveries. J. Unintentional Errors and Omissions Any unintentional error or omission in the description of, or failure to describe completely, any premises or operations intended to be covered by this poticy, shall not invalidate or affect the coverage for those operations or premises. However, the insured must report such error or omission to the company as soon as practicable after its discovery. K. When Loss is Payable Coverage under this policy will not apply unless and until the insured or the insured's underlying insurer has paid or is legally obligated to pay the full amount of the total Applicable Limits of underlying insurance. When theamountof loss is determined by an agreed settlement or a final judgment againsi an insured obtained after an actual trial, we will promptly pay on behalf of the insured the amount of loss covered under the terms of this poticy. L. Audit of Books and Records We may audit and examine your books and records as Ihey relate to this policy at any time during the period of this poticy and for up to three (3) years after the expiration or termination of this policy. M. Changes Notice to any agent or knowledge possessed by any agent or any other person wilt not effect a waiver or a change in any part of this policy. This poticy can only be changed by a wrilten endorsement that becomes a part of this policy. N. First Named Insured The person or organization first named in ttem 1. of the Declarations is responsible for the payment of atl premiums. The first Named Insured will act on behalf of at! other insureds for the giving and receiving of notice of cancellation or any other notice required under this policy or by statute or regulation, forthe receipt and acceptance ofthis poticy and any endorsements forming a part of this policy, and for the receiving of any return premiums that become payable under this policy. O. Inspection We have the right, but are not obligated to inspect the insured's premises and operations at any time. Our inspections are not safety inspections. They relate only to the insurability ofthe premises and operations and the premium to be charged. We may provide reports on the conditions we find. We may also recommend changes. While these reports may help reduce losses, we do not undertake to perform the duty of any person or organization to provide for the health or safety of workers or the public. We do not warrant that the premises or operations are safe or healthful, or that they comply with laws, regulations, codes or standards. P. Legal Action Against Us There will be no right of action against us under this insurance unless; 1. You have complied with atl the terms of this policy; and 2. The amouni you owe has been determined by settlement with our consent or by actual trial and final judgment. This insurance does not give anyone the right to add us as a party in an action against you to determine your liability. U-SXS-100-A CW (09/11) Page 9 of 10 1 of 1 (TLJ01) CERTIFICATE HOLDER © 1988-2010 ACORD CORPORATION. All rights reserved. ACORD 25 (2010/05) AUTHORIZED REPRESENTATIVE CANCELLATION DATE (MM/DD/YYYY)CERTIFICATE OF LIABILITY INSURANCE LOCJECTPRO-POLICY GEN'L AGGREGATE LIMIT APPLIES PER: OCCURCLAIMS-MADE COMMERCIAL GENERAL LIABILITY GENERAL LIABILITY PREMISES (Ea occurrence)$DAMAGE TO RENTED EACH OCCURRENCE $ MED EXP (Any one person) $ PERSONAL & ADV INJURY $ GENERAL AGGREGATE $ PRODUCTS - COMP/OP AGG $ $RETENTIONDED CLAIMS-MADE OCCUR $ AGGREGATE $ EACH OCCURRENCE $ UMBRELLA LIAB EXCESS LIAB DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (Attach ACORD 101, Additional Remarks Schedule, if more space is required) INSRLTR TYPE OF INSURANCE POLICY NUMBER POLICY EFF(MM/DD/YYYY)POLICY EXP(MM/DD/YYYY)LIMITS WC STATU-TORY LIMITS OTH-ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE E.L. DISEASE - POLICY LIMIT $ $ $ ANY PROPRIETOR/PARTNER/EXECUTIVE If yes, describe underDESCRIPTION OF OPERATIONS below (Mandatory in NH) OFFICER/MEMBER EXCLUDED? WORKERS COMPENSATION AND EMPLOYERS' LIABILITY Y / N AUTOMOBILE LIABILITY ANY AUTO ALL OWNED SCHEDULED HIRED AUTOS NON-OWNEDAUTOSAUTOS AUTOS COMBINED SINGLE LIMIT BODILY INJURY (Per person) BODILY INJURY (Per accident) PROPERTY DAMAGE $ $ $ $ THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. INSR ADDL WVD SUBR N / A $ $ (Ea accident) (Per accident) THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). The ACORD name and logo are registered marks of ACORD COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: INSURED PHONE(A/C, No, Ext): PRODUCER ADDRESS:E-MAIL FAX(A/C, No): CONTACTNAME: NAIC # INSURER A : INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : INSURER(S) AFFORDING COVERAGE SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. 04/30/2021 Parker, Smith & Feek, Inc. 2233 112th Avenue NE Bellevue, WA 98004 425-709-3600 425-709-7460 Travelers Indemnity Co. Union Pacific Railroad Company c/o Lakeside Industries, Inc. P.O. Box 7016 Issaquah, WA 98027 A Railroad Protective - Job 19-3003 SPS5R666793IND 04/30/2021 04/30/2022 $2,000,000 Per Occurrence $6,000,000 Aggregate S 212th St Preservation 72nd Ave S to 84th Ave S (East Valley Hwy) Project Number 19-3003 Exhibit of Insurance CANCELS AND REPLACES PREVIOUSLY ISSUED CERTIFICATE. City of Kent Public Works Department 400 West Gowe Kent, WA 98032 Local Agency Performance Bond PERFORIUIANCE BOHD to lCity of Kent or Bond No. fi742s4s4 Countyl, WA The tCitv ol Kent or Countyl, Washington (lCity or Gounty} has awarded io Lakeside lndustries, lnc. (Principal), a contract far the constructisn of lhe project designated as 9 ?131[-Sr PreservationiProiect lia f +iooi*lln*iticafioni, Washington (Contract), and said Principal is required to furnish a bond for performance of all oblig-tDniTfr-d6t:lhe Contract. *72nd Ave. S. to 84th Ave. S. (East Valley Highway) / Federal Aid Number: STPUL-1250(009) Travelers Casualty and Surety The Principal, and Company ot nmeii"a '(Surety), a enrporation, organized under the laws of the State of connecticut and licensed to do business in the State of Wasnington as sure$ and named in the current list of "surely Companies Acceptable in Federal Bonds' as published in the Federal Register by the Audit Siaff_Burpau of Nccounts, U l.Jrea..sury,Dspt., are jointly and severauy herd and nrmry bound to the lcity or.Gounv], in the sum " :i?lfllf!,:.t91ff81;f;f i,llu.t]l3Jl3'*'o us Dollars(g 1,859,868.10 )Total ContractAmount, subjecttotheprovisionsherein. This statutory performance bond shall become null and void, if and when the Principal, its heirs, executors, administraiors, successors, or assigns shatl well and feithtully perform all of the Principal's obligations under the Contract and fulfill all terms and conditign$ of all duly authorized modifications, additions, and changes to said Contract that may hereafrer be made, at the iirne and in the manner therein specilied; and if such performance obligations have not been fulfilled, this bond shall remain in force and effect. The Surety for value received agrees thet no change, extension of time, alteration or addition to the terms of the Contract, the specifications accompanying the Contract, or to the work to be performed under the Contract shall in any way affecl its obligation on this bond, and waives notice of any change, extension of lime, alteration or addition to the terms of the Contract or the worle performed. The Surety agrees that modilications and changes to the terms and conditions of the Contract that incrcase the total amount to be paid the Principal shall automatically increase tha obligation of the Surety on this bond end notice to $urety is not required for such increased obligation. This bond may be executed in two (2) original counterparts, and shall be signed by ths parties'duly authorized officers. This bond will only be accepted if it is accompanied by a fully executed and original power of Eftorney for tho office executing on behalf of the surety Lakeside lndustries, lnc.Travelers Casualty and Surety Company of America PRINCIPAL SU 2A)0412312021 Principal Date Surety DP>. tJosr rTD J vlul*'u Susan B. Larson 04t2312021 Printed Name Date Prinhsd Name Attorney-in-Fact Dale Title Name, address, and telephone of local office/agent of Surety Cornpany is: Parker, Smith & Feek, lnc. 2233 1121h Ave NE, Bellevue, WA 98004 (425) 709-3600 Approved as to form Title HARTtrORD, QONN, * [City or County]Attorney, [Ci$ of DOT Formz7?-002AEF 08/20r2 or 76 CountyJ Date 5/6/21 Kent ? TRAVELER6?' Travelers Casualty and Surety Company of America Travelers Casualty and Surety Company St. Paul Fire and Marine Insurance Company POWER OF ATTORNEY KNOW ALL MEN By THESE pRESENTS: That Travelers Casualty and surety company of America, Travelers casualty and surety company, and st. peul Fire and Marine lnsurance Company are corporations duly organized rinder the laws of the State of Connecticut (herein collectively called the "Companies"), and that the Companies do hereby make, constitute and appoint Susan B. Larson of BELLEVUE washington , iheir true and iawful Attorney-in-Fact to sign, execute, seal and acknowledge any and all bonds, recognizances, conOitioriat undertakings and other writings obtigatory in the nature thereof on behalf of the Companies in their business of guaranteeing the fidelity of persons, g-uaranteeing the pjrforman'ce of contracts and executing or guaranteeing bonds and undertakings required or permitted in any actions or proceedings allowed by law. lN WTNESS SHEREOF, the Companies have caused this instrument to be signed, and their corporate seals to be hereto affixed, this 17th day of January, 2019. State of Connecticut City of Hartford ss. By: L Vice President On this the 1?th day of January, 2019, before me personally appeared Roberl L. Raney, who acknowledged himself to be the Senior Vice President of Travelers Casualty and Surety'Corpany of America, Traveiers Casualty and Surety Company, and St. Paul Fire and Marine lnsurance Company, and that he, as such, being authorized so to do, executed the foregoing instrument ior the purposes therein contained by signing on behalf of said Companies by himself as a duly authorized officer. lN WITNESS WHEREOF, I hereunto set my hand and official seal. My Commission expires the 30th day of June, 2021 Anna P. Nowik, Notary Public t This power of Attorney is granted under and by the authority of the following resolutions adopted by the Boards of Directors of Travelers Casualty and Surety Company of Amerid, Travelers Casualtyand Surety iompany, and St. Paul Fire and Marine lnsurance Company, which resolutions are now in full force and effect, reading as follows: RESOLVED, that the Chairman, the President, any Vice Chairman, any Executive Vce President, any Senior Vice President, any Vice President, any Second Vice president, the Treasurer, any Assistaht Treasurer, the Coiporate Secretary or any Assistant Secretary may appoint Attorneys.in-Fact and Agents to act for and on behalf of the Company and may give such appointee such authority as his or her certificate of authority may prescribe to sign wiin tne company's name and seal with the Company's sbal bonds, recognizances, contracts of indemnity, and othel writings obligatory in the nature of a bond, recognizan'"", or ronoitional undertaking, anO 6ny of said officers oi ttre Board of Directors at any time may remove any such appointee and revoke the power given him or her; and it is FURTHER RESOLVED, that the Chairman, the President, any Vice Chairman, any Executive Vice-President, any Senior Vice President or any Vice president may deligate all or any part of the foregoing authbrity to one or more officers or employees of lhis Company, provided that each such delegation is in writing and a copy thereof is filed in the office of the Segetary; and it is FURTHER RESOLVED, that any bond, recognizance, contract of indemnity, or writing obligatory in the nature of a bond, recognizance, or conditional undertaking shall be valid and binding uponlhe company when (a) signed by the Preeident, any Vice Chairman, any Executive Vice President, any Senior Vici president or any Vice President, any Second Vice President, the Treasurer, any Assistant Treasurer, the Corporate Secretary or any Assistant Secretary and duly attested and sealed with the Company's seal by a Secretary or Assistant Secretary, or (b) duly execlted (under seal, if required) by one oi more Att'orneys.in-Fact and Agents pursuant to the power prescribed in his or her certificate or their certificates of authority or by one or more Company offlcers pursuant to a written delegation of authority; and it is FURTHER RESOLVED, that the signature of each of the following officers: President, any Executive Vice President, any Senior Vce President, any Vice president, any Assistant Vice Presilent, any Secretary, any Assisiant Secretary, and the seal of the Company may be affixed by facsimile to any Power ol Attorney or to any certificate relating thereto appointing Reiident Vice Presidents, Resident Assistant Secretaries or Attornels-in-Fact for purposes. only of executing and atiesting bonds and-undertaking's and 6ther writings obligatory in the nature thereof, and any such Power of Attorney or certificate bearing such facsimile signatuie or facsimile seal shall be valid and binding upon the Company and any such power so executed and certified by such facsimile signature and facsimile seal shall be valid and binding on the Compiny in the future with respect to any bond or understanding to which it is attached. l, Kevin E, Hughes, the undersigned, Assistant Secretary of Travelers Casualty and Surety Co,mpany of America, Travelers Casualty and Surety- io11pany, and 5t. paul Fire and Marine lnsurance Company, do hereby certify that the above and foregoing is a true and correct copy of the Power of Attomey executed by said Companies, which remains in full force and effect. p"1u6 11.ri" 23rd day of APril , 2021 { Kevin E. Hughes,Secretary To verify the authenticity of this Power of Attomey, plase cail us at 7-800-427-3880. Please refer to the above-named Attomey-in-Fact and the detaits of the bond to whlch lhis Power of Altorney is altached' ricllAAY da |,'JBilc odt4rll a^r Local Agency PaYrnent Bond -- HighwaY Construction PUBLIC WORKS PAYMENT BOND to [GitY of Kent o11 Countyl, WA Bond No. 1o742u54 The tcitv of Kent or Countyl, Washington ([City or gountyl) has awarded io Lakeside lndustries, lnc. {Principal), a contract for the construction of tho project designated as S. 2'l2th St. PreservationiProject No. 19-3003 , in flocationJ, Washington (Con{ract), and said Principal is required under tne-I6ifrs oi ttiai-ioiiffit to furnish a payrfreint tioi-d"ifr-Sccord with Title 39.08 Revised Code of Washington (RCW) and (where appiicable)60.28 RCW Travelers Casualty and *72nd Ave_ S. to 84th Ave. S. (East Valley Highway) Federal Aid Number: STPUL-1250(009) The Principal, and Surety Company of America {Surety}, a corporation organized under the iaws of the Siate of Connecticut and licensed to do busines$ in the State of Washington as sur€ly and named in the current list of "surety Companies Acceptable in Federal Bonds" as published in the Federal Registar by the Audit Staff Bureau of Accounts, U.S. Treasury Dept., are jointly and severelly held and firmly bound to the [City or eounty], in the sum of One Mllllon Hundred Ftfly Nlne Thousand Eight Hundred US Dollar$ ($ 1,859,868.10 ) Totai Contract Announl, subject s This statutory payment bond shall become null and void, if and when the Principal, its heirs, execuiors, administrators, successors' or assigns shall pay all persons in accordance with RCW 39.08, 39.12, and 60.28 including all rryorkers, laborers, mechanics, subcontractors, and rnaterialmen, end all person who shall supply such contractor or subcontractor with provisions and supplies for the calying on of such work, and all taxes incurred on said Contract under Titles 50 and 51 RCW and all taxes imposed on the principal under Title S2 RcW and if such payrnent obtigations have not been fulfilled, this bond shall remairr in full force and effect. The Surety for value received agrees that no change, extension of time, alteralion or addition to the terms of the Contract, the specifications accompanying the Contract, or to the work to be performed under lhe Contract shall in any way affect its obiigation on this bond, and waives notice of any changes, exten$ion of time, alteration oraddition to the terms of the Contract or the work porforrned. The Surety agrees thai modifications and changes to ihe terrns and conditions of the Contract lhat increasa the total amount to be paid the principal shall automaiically increase the obligation otthe Surety on thi$ bond and notice to Surety is not required for such increased obligation. This bond rnay be executed in two (2) original counterparts, and shall be signed by the parties'duly authorized otficers, This bond will only be accepted if it is accompanied by a fully executed and original power cf attorney for the oflice executing on behalf of the surBty 'RINCIFAL Lakesidelndustries,lnc.SU Travelers Casualty and Surety Company of America 4t2312021 Principal S Date w\4 Surety Signature Susan B. Larson Date 4t2312021rl Printed Name Attorney-in-Fact DatePrinted Name ACo Title Name, address. and telephone cf local office/agent of Sure$ Company is: Parker, Smith & Feek, lnc. 2233 1121h Ave NE, Bellevue, WA 98004 (425) 709-3600 Appmved as to form: Tifle [City or CountylAttorney, [City of DCIT Form272-003AEFoUm12 or 77 Countyl Date 5/6/21 Kent TRAVELERJ?' Travelers Casualty and Surety Company of America Travelers Casualty and Surety Company St. Paul Fire and Marine Insurance Company POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That Travelers Casualty and Surety Company of America, Travelers Casualty and Surety Company, and St. paul Fire and Marine lnsurance Company are corporations duly organized under the laws of the State of Connecticut (herein collectively called the "Companies"), and that the Companies do hereby make, constitute and appoint Susan B. Larson of BELLEVUE Washington , their true and lawful Attorney-in-Fact to sign, execute, seal and acknowledge any and all bonds, recognizances, conditiofal undertakings and other writings obligatory in the nature thereof on behalf of the Companies in their business of guaranteeing the fidelity of persons, giraranteeing the performance of contracts and executing or guaranteeing bonds and undertakings reqqired or permitted in any actions or proceedings allowed by law. lN WTNESS WHEREOF, the Companies have caused this instrument to be signed, and their corporate seals to be hereto affixed, this 17th day of January, 201s. State of Connecticut City of Hartford ss.L. Ran or Vice President On this the 1?th day of January, 20'19, before me personally appeared Robert L. Raney, who acknowledged himself to be the Senior Vice President of Travelers Casualty and Surety Company of America, Travelers Casualty and Surety Company, and St. Paul Fire and Marine lnsurance Company, and that he, as such, being authorized so to do, executed the foregoing instrument for the purposes therein contained by signing on behalf of said Companies by himself as a duly authorized officer. lN WITNESS WHEREOF, I hereunto set my hand and official seal. My Commission expires the 30th day of June, 2021 Anna P. Nowik, Notary Public This power of Attorney is granted under and by the authority of the following resolutions adopted by the Boards of Directors of Travelers Casualty and Surety Company of Americi, Travelers Casualty and Surety Company, and St. Paul Fire and Marine lnsurance Company, which resolutions are now in full force and effect, reading as follows: RESOLVED, that the Chairman, the President, any Vice Chairman, any Executive Vce President, any Senior Vice President, any Vice President, any Second Vice President, the Treasurer, any Assistant Treasurer, the Corporate Secretary or any Assistant Secretary may appoint Attorneys"in-Fact and Agentsto act for and on behalf of the Company and may give such appointee such authority as his or her certificate of authority may prescribe to sign with the company's name and seal with the Company's seal bonds, recognizances, contracts of indemnity, and other writings obligatory in the nature of a bond, recognizanie, or conditional undertaking, and 5ny of said officers or the Board of Directors at any time may remove any such appointee and revoke the power given him or her; and it is FURTHER RESOLVED, that the Chairman, the President, any Vce Chairman, any Executive Vice President, any Senior Vice President or any Vice President may delegate all or any part of the foregoing authority to one or more officers or employees of this Company, provided that each such delegation is in writing and a copy thereol is liled in the office of the Secretary; and it is FURTHER RESOLVED, that any bond, recognizance, contract of indemnity, or writing obligatory in the nature of a bond, recognizance, or conditional undertaking shall be valid and binding upon the Company when (a) signed by the President, any Vice Chairman, any ExecutMe Vice President, any Senior VicL president or any Vice President, any Second Vice President, the Treasurer, any Assistant Treasurer, the Corporate Sedetary or any Assistant Secretary and duly attested and sealed with the Company's seal by a Secretary or Assistant Secretary; or (b) duly executed (under seal, if required) by one oi more Attorney+in-Fact and Agents pursuant to the power prescribed in his or her certificate or their certificates of authority or by one or more Company offlcers pursuant to a wriften delegation of authority; and it is FURTHER RESOLVED, that the signature of each of the following officers: President, any Executive Vice President, any Senior Vice President, any Vice President, any Assistant Vice President, any Secretary, any Assistant Secretary, and the seal of the Company may be affixed by facsimile to any Power of Attorney or to any certificate relating thereto appoihting Resident Vice Presidents, Resident Assistant Secretaries or Attorneysjn-Fact for purposes. only of executing and attesting bonds and undertakings and other writings obligatory in the nature thereof, and any such Power of Attorney or certifioate bearing such facsimile signatuie or facsimile seal shatl be valid and binding upon the Company and any such power so executed and certified by such facsimile signature and faJsimile seal shall be valid and binding on the Company in the future with respect to any bond or understanding to which it is attached. l, Kevin E. Hughes, the undersigned, Assistant Secretary of Travelers Casualty and Surety Company of America, Travelers Casualty and Surety 6ompany, and 5t. Paul Fire and Marine lnsurance Company, do hereby certify that the above and foregoing is a true and correct copy of the Power of Attorney executed by said Companies, which remains in full force and effect. 6"1u6 11.11. 23rd day of April , 2021 t* { /44^TGvin E. Hughes, AssiEtant secretary To verify the authenticity of lhis Power of Atton eb plase call us at 7-8O0-42t-388O. Please refer to the ahove-named Attomey-in-Fact and the detalls of the bond to which this Power of Attorney is attached' By: HARTFOffO. cot{ti. t oilsrlr ara rjsfARl df 9tl?.LlC HAFTFOfrOt coilN- 212th St. Preservation/Holcomb March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SPECIAL PROVISIONS CONTENTS PAGE INTRODUCTION .......................................................................... SP-1 DIVISION 1 GENERAL REQUIREMENTS ................................. SP-3 1-01 Definitions and Terms ................................................. SP-3 1-02 Bid Procedures and Conditions ..................................... SP-5 1-03 Award and Execution of Contract .................................. SP-11 1-04 Scope of the Work ..................................................... SP-11 1-05 Control of Work ......................................................... SP-13 1-06 Control of Material ..................................................... SP-17 1-07 Legal Relations and Responsibilities to the Public ............ SP-19 1-08 Prosecution and Progress ............................................ SP-53 1-09 Measurement and Payment ......................................... SP-58 1-10 Temporary Traffic Control ........................................... SP-59 DIVISION 2 EARTHWORK ...................................................... SP-62 2-02 Removal of Structures and Obstructions ........................ SP-62 2-03 Roadway Excavation and Embankment .......................... SP-65 2-06 Subgrade Preparation ................................................. SP-66 2-07 Watering .................................................................. SP-67 2-09 Structure Excavation .................................................. SP-67 DIVISION 4 BASES ................................................................ SP-69 4-03 Gravel Borrow ........................................................... SP-69 4-04 Ballast and Crushed Surfacing ...................................... SP-70 DIVISION 5 SURFACE TREATMENTS AND PAVEMENTS .......... SP-72 5-02 Bituminous Surface Treatment ..................................... SP-72 5-04 Hot Mix Asphalt ......................................................... SP-72 5-05 Cement Concrete Pavement......................................... SP-102 DIVISION 7 DRAINAGE STRUCTURES, STORM SEWERS, SANITARY SEWERS, WATER MAINS AND CONDUITS ........... SP-103 7-05 Manholes, Inlets, Catch Basins, and Drywells ................. SP-103 7-12 Valves for Water Mains ............................................... SP-105 DIVISION 8 MISCELLANEOUS CONSTRUCTION ..................... SP-107 8-01 Erosion Control and Water Pollution Control ................... SP-107 8-02 Roadside Restoration .................................................. SP-111 8-04 Curbs, Gutters, and Spillways ...................................... SP-118 8-05 Monitoring Well ......................................................... SP-119 8-06 Cement Concrete Driveway Entrances ........................... SP-120 8-09 Raised Pavement Markers ........................................... SP-120 8-10 Guide Posts .............................................................. SP-122 8-13 Monument Cases ....................................................... SP-123 212th St. Preservation/Holcomb March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 KENT SPECIAL PROVISIONS TABLE OF CONTENTS PAGE DIVISION 8 MISCELLANEOUS CONSTRUCTION 8-14 Cement Concrete Sidewalks......................................... SP-124 8-20 Illumination, Traffic Signal Systems, Intelligent Transportation Systems, and Electrical .......................... SP-126 8-21 Permanent Signing ..................................................... SP-130 8-22 Pavement Marking ..................................................... SP-132 8-23 Temporary Pavement Markings .................................... SP-139 8-28 Pothole Utilities ......................................................... SP-140 8-30 Project Signs ............................................................. SP-141 DIVISION 9 MATERIALS ........................................................ SP-143 9-02 Bituminous Materials .................................................. SP-143 9-03 Aggregates ............................................................... SP-144 9-13 Riprap, Quarry Spalls, Slope Protection, and Rock For Erosion and Scour Protection and Rock Walls .................. SP-146 9-14 Erosion Control and Roadside Planting ........................... SP-146 9-28 Signing Materials and Fabrication ................................. SP-150 9-29 Illumination, Signal, Electrical ...................................... SP-152 9-30 Water Distribution Materials ........................................ SP-154 9-34 Pavement Marking Materials ........................................ SP-157 Standard Plans .......................................................... SP-158 KENT STANDARD PLANS ............................................................. A-1 WSDOT STANDARD PLANS .......................................................... A-2 TRAFFIC CONTROL PLANS .......................................................... A-3 PROJECT SIGN ............................................................................ A-4 CONTRACTOR’S RIGHT OF ENTRY AGREEMENT ........................... A-5 BNSF ROADWAY SURFACING AGREEMENT .................................. A-6 SPECIFICATION - RETROREFLECTIVE AND SKID RESISTANT BIKE LANE GREEN PREFORMED THERMOPLASTIC PAVEMENT MARKINGS .................................................................................. A-7 STATE AND FEDERAL PREVAILING WAGE RATES ........................ A-8 212th St. Preservation/Holcomb SP - 1 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SPECIAL PROVISIONS The following Special Provisions are made a part of this contract and supersede any conflicting provisions of the 2021 Standard Specifications for Road, Bridge and Municipal Construction, and the foregoing Amendments to the Standard Specifications. Several types of Special Provisions are included in this contract; General, Region, Bridges and Structures, and Project Specific. Special Provisions types are differentiated as follows: (date) General Special Provision (******) Notes a revision to a General Special Provision and also notes a Project Specific Special Provision. (Regions1 date) Region Special Provision (BSP date) Bridges and Structures Special Provision General Special Provisions are similar to Standard Specifications in that they typically apply to many projects, usually in more than one Region. Usually, the only difference from one project to another is the inclusion of variable project data, inserted as a “fill-in”. Region Special Provisions are commonly applicable within the designated Region. Region designations are as follows: Regions1 ER Eastern Region NCR North Central Region NWR Northwest Region OR Olympic Region SCR South Central Region SWR Southwest Region WSF Washington State Ferries Division Bridges and Structures Special Provisions are similar to Standard Specifications in that they typically apply to many projects, usually in more than one Region. Usually, the only difference from one project to another is the inclusion of variable project data, inserted as a “fill-in”. Project Specific Special Provisions normally appear only in the contract for which they were developed. 212th St. Preservation/Holcomb SP - 2 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 INTRODUCTION TO THE SPECIAL PROVISIONS (December 10, 2020 APWA GSP) The work on this project shall be accomplished in accordance with the Standard Specifications for Road, Bridge and Municipal Construction, 2021 edition, as issued by the Washington State Department of Transportation (WSDOT) and the American Public Works Association (APWA), Washington State Chapter (hereafter “Standard Specifications”). The Standard Specifications, as modified or supplemented by these Special Provisions, all of which are made a part of the Contract Documents, shall govern all of the Work. These Special Provisions are made up of both General Special Provisions (GSPs) from various sources, which may have project-specific fill-ins; and project-specific Special Provisions. Each Provision either supplements, modifies, or replaces the comparable Standard Specification, or is a new Provision. The deletion, amendment, alteration, or addition to any subsection or portion of the Standard Specifications is meant to pertain only to that particular portion of the section, and in no way should it be interpreted that the balance of the section does not apply. The project-specific Special Provisions are not labeled as such. The GSPs are labeled under the headers of each GSP, with the effective date of the GSP and its source. For example: (March 8, 2013 APWA GSP) (April 1, 2013 WSDOT GSP) Also incorporated into the Contract Documents by reference are: • Manual on Uniform Traffic Control Devices for Streets and Highways, currently adopted edition, with Washington State modifications, if any • Standard Plans for Road, Bridge and Municipal Construction, WSDOT/APWA, current edition • Standard Plans (M21-01) for Road, Bridge and Municipal Construction as prepared by the Washington State Department of Transportation and the American Public Works Association, current edition; • Kent Design and Construction Standards, current edition; • American Water Works Association Standards, current edition; • The current edition of the “National Electrical Code.” Contractor shall obtain copies of these publications, at Contractor’s own expense. 212th St. Preservation/Holcomb SP - 3 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Kent Special Provisions (“Kent Special Provisions” or “KSP”) modify and supersede any conflicting provisions of the 2021 Standard Specifications for Road, Bridge, and Municipal Construction, as prepared by the Washington State Department of Transportation and the Washington State Chapter of the American Public Works Association, including all published amendments issued by those organizations (“WSDOT Standard Specifications”). Otherwise all provisions of the WSDOT Standard Specifications shall apply. All references in the WSDOT Standard Specifications to the State of Washington, its various departments or directors, or to the contracting agency, shall be revised to include the City and/or City Engineer, except for references to State statutes or regulations. Finally, all of these documents are a part of this contract. DIVISION 1 – GENERAL REQUIREMENTS DESCRIPTION OF WORK (March 13, 1995, WSDOT GSP) This Contract provides for the improvement of S. 212th Street from 72nd Avenue S. to 84th Avenue S. (East Valley Highway) and other work, all in accordance with the attached Contract Plans, these Contract Provisions, and the Standard Specifications. 1-01 DEFINITIONS AND TERMS 1-01.3 Definitions (January 4, 2016 APWA GSP) Delete the heading Completion Dates and the three paragraphs that follow it, and replace them with the following: Dates Bid Opening Date The date on which the Contracting Agency publicly opens and reads the Bids. Award Date The date of the formal decision of the Contracting Agency to accept the lowest responsible and responsive Bidder for the Work. Contract Execution Date The date the Contracting Agency officially binds the Agency to the Contract. Notice to Proceed Date The date stated in the Notice to Proceed on which the Contract time begins. Substantial Completion Date The day the Engineer determines the Contracting Agency has full and unrestricted use and benefit of the facilities, both from the operational and safety standpoint, any remaining traffic disruptions will be rare and brief, and only minor incidental work, replacement of temporary substitute facilities, plant establishment periods, or correction or repair remains for the Physical Completion of the total Contract. 212th St. Preservation/Holcomb SP - 4 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Physical Completion Date The day all of the Work is physically completed on the project. All documentation required by the Contract and required by law does not necessarily need to be furnished by the Contractor by this date. Completion Date The day all the Work specified in the Contract is completed and all the obligations of the Contractor under the contract are fulfilled by the Contractor. All documentation required by the Contract and required by law must be furnished by the Contractor before establishment of this date. Final Acceptance Date The date on which the Contracting Agency accepts the Work as complete. Supplement this Section with the following: All references in the Standard Specifications, Amendments, or WSDOT General Special Provisions, to the terms “Department of Transportation”, “Washington State Transportation Commission”, “Commission”, “Secretary of Transportation”, “Secretary”, “Headquarters”, and “State Treasurer” shall be revised to read “Contracting Agency”. All references to the terms “State” or “state” shall be revised to read “Contracting Agency” unless the reference is to an administrative agency of the State of Washington, a State statute or regulation, or the context reasonably indicates otherwise. All references to “State Materials Laboratory” shall be revised to read “Contracting Agency designated location”. All references to “final contract voucher certification” shall be interpreted to mean the Contracting Agency form(s) by which final payment is authorized, and final completion and acceptance granted. Additive A supplemental unit of work or group of bid items, identified separately in the Bid Proposal, which may, at the discretion of the Contracting Agency, be awarded in addition to the base bid. Alternate One of two or more units of work or groups of bid items, identified separately in the Bid Proposal, from which the Contracting Agency may make a choice between different methods or material of construction for performing the same work. Business Day A business day is any day from Monday through Friday except holidays as listed in Section 1-08.5. Contract Bond The definition in the Standard Specifications for “Contract Bond” applies to whatever bond form(s) are required by the Contract Documents, which may be a combination of a Payment Bond and a Performance Bond. 212th St. Preservation/Holcomb SP - 5 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Contract Documents See definition for “Contract”. Contract Time The period of time established by the terms and conditions of the Contract within which the Work must be physically completed. Notice of Award The written notice from the Contracting Agency to the successful Bidder signifying the Contracting Agency’s acceptance of the Bid Proposal. Notice to Proceed The written notice from the Contracting Agency or Engineer to the Contractor authorizing and directing the Contractor to proceed with the Work and establishing the date on which the Contract time begins. Traffic Both vehicular and non-vehicular traffic, such as pedestrians, bicyclists, wheelchairs, and equestrian traffic. 1-02 BID PROCEDURES AND CONDITIONS 1-02.1 Prequalification of Bidders DELETE THIS SECTION AND REPLACE WITH THE FOLLOWING: 1-02.1 Qualifications of Bidder (January 24, 2011 APWA GSP) Before award of a public works contract, a bidder must meet at least the minimum qualifications of RCW 39.04.350(1) to be considered a responsible bidder and qualified to be awarded a public works project. SECTION 1-02.2 IS DELETED AND REPLACED WITH THE FOLLOWING: 1-02.2 Plans and Specifications (Kent Special Provisions) Upon awarding the Contract, the City shall supply to the Contractor, for its own use, up to ten (10) copies of the plans and specifications. If the Contractor requests more than ten (10) copies, the City may require the Contractor to purchase the additional sets. 1-02.4(1) General (August 15, 2016 APWA GSP Option A) The first sentence of the last paragraph is revised to read: Any prospective Bidder desiring an explanation or interpretation of the Bid Documents, must request the explanation or interpretation in writing soon enough 212th St. Preservation/Holcomb SP - 6 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 to allow a written reply to reach all prospective Bidders before the submission of their Bids. SECTION 1-02.5 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-02.5 Proposal Forms (Kent Special Provision) Prospective bidders may obtain Bid Documents including a “Bid Proposal” for the advertised project by downloading at no charge at KentWA.gov/doing- business/bids-procurement; however, a prospective bidder remains responsible to obtain Bid Documents. 1-02.6 Preparation of Proposal (December 10, 2020 APWA GSP, Option A) Supplement this section with the following: The Bidder shall submit with the Bid a completed Disadvantaged Business Enterprise (DBE) Utilization Certification, when required by the Special Provisions. For each and every DBE firm listed on the Bidder’s completed Disadvantaged Business Enterprise Utilization Certification, the Bidder shall submit written confirmation from that DBE firm that the DBE is in agreement with the DBE participation commitment that the Bidder has made in the Bidder’s completed Disadvantaged Business Enterprise Utilization Certification. WSDOT Form 422 031 (Disadvantaged Business Enterprise Written Confirmation Document) is to be used for this purpose. Bidder must submit good faith effort documentation only in the event the bidder’s efforts to solicit sufficient DBE participation have been unsuccessful. The Bidder shall submit a DBE Bid Item Breakdown form defining the scope of work to be performed by each DBE listed on the DBE Utilization Certification. If the Bidder lists a DBE Trucking firm on the DBE Utilization Certification, then the Bidder must also submit a DBE Trucking Credit Form (WSDOT Form 272-058) documenting how the DBE Trucking firm will be able to perform the scope of work subcontracted to them. Directions for delivery of the Disadvantaged Business Enterprise Written Confirmation Documents, Disadvantaged Business Enterprise Good Faith Effort documentation, DBE Bid Item Breakdown Form and the DBE Trucking Credit Form are included in Section 1-02.9. 1-02.6(1) Recycled Materials Proposal (January 4, 2016 APWA GSP) The Bidder shall submit with the Bid, its proposal for incorporating recycled materials into the project, using the form provided in the Contract Provisions. 212th St. Preservation/Holcomb SP - 7 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 1-02.7 Bid Deposit (March 8, 2013 APWA GSP) Supplement this section with the following: Bid bonds shall contain the following: 1. Contracting Agency-assigned number for the project; 2. Name of the project; 3. The Contracting Agency named as obligee; 4. The amount of the bid bond stated either as a dollar figure or as a percentage which represents five percent of the maximum bid amount that could be awarded; 5. Signature of the bidder’s officer empowered to sign official statements. The signature of the person authorized to submit the bid should agree with the signature on the bond, and the title of the person must accompany the said signature; 6. The signature of the surety’s officer empowered to sign the bond and the power of attorney. If so stated in the Contract Provisions, bidder must use the bond form included in the Contract Provisions. If so stated in the Contract Provisions, cash will not be accepted for a bid deposit. SECTION 1-02.7 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-02.7 Bid Deposit (Kent Special Provision) A deposit of at least 5 percent of the total Bid shall accompany each Bid. This deposit may be cash, cashier’s check, or a proposal bond (Surety bond). Any proposal bond shall be on the City’s bond form and shall be signed by the Bidder and the Surety. A proposal bond shall not be conditioned in any way to modify the minimum 5- percent required. The Surety shall: (1) be registered with the Washington State Insurance Commissioner, and (2) appear on the current Authorized Insurance List in the State of Washington published by the Office of the Insurance Commissioner. The failure to furnish a Bid deposit of a minimum of 5 percent with the Bid shall make the Bid nonresponsive and shall cause the Bid to be rejected by the Contracting Agency. 1-02.9 Delivery of Proposal (October 1, 2020 APWA GSP Option C) Delete this section and replace it with the following: 212th St. Preservation/Holcomb SP - 8 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Each Proposal shall be submitted in a sealed envelope, with the Project Name and Project Number as stated in the Call for Bids clearly marked on the outside of the envelope, or as otherwise required in the Bid Documents, to ensure proper handling and delivery. To be considered responsive on a FHWA-funded project, the Bidder may be required to submit the following items, as required by Section 1-02.6: • DBE Written Confirmation Document from each DBE firm listed on the Bidder’s completed DBE Utilization Certification (WSDOT 272-056); • Good Faith Effort (GFE) Documentation • DBE Bid Item Breakdown (WSDOT 272-054) • DBE Trucking Credit Form (WSDOT 272-058) These documents, if applicable, shall be received either with the Bid Proposal or as a Supplement to the Bid. The documents shall be received no later than 48 hours (not including Saturdays, Sundays and Holidays) after the time for delivery of the Bid Proposal. If submitted after the Bid Proposal is due, the document(s) shall be submitted as follows: 1. By facsimile to the following FAX number: 253-856-6725 or 2. By e-mail to the following e-mail address: CityClerk@kentwa.gov All other information required to be submitted with the Bid Proposal must be submitted with the Bid Proposal itself, at the time stated in the Call for Bids. Proposals that are received as required will be publicly opened and read as specified in Section 1-02.12. The Contracting Agency will not open or consider any Bid Proposal that is received after the time specified in the Call for Bids for receipt of Bid Proposals, or received in a location other than that specified in the Call for Bids. The Contracting Agency will not open or consider any “Supplemental Information” (DBE confirmations or GFE documentation) that is received after the time specified above, or received in a location other than that specified above. If an emergency or unanticipated event interrupts normal work processes of the Contracting Agency so that Proposals cannot be received at the office designated for receipt of bids as specified in Section 1-02.12 the time specified for receipt of the Proposal will be deemed to be extended to the same time of day specified in the solicitation on the first work day on which the normal work processes of the Contracting Agency resume. 1-02.10 Withdrawing, Revising, or Supplementing Proposal (July 23, 2015 APWA GSP) Delete this section, and replace it with the following: After submitting a physical Bid Proposal to the Contracting Agency, the Bidder may withdraw, revise, or supplement it if: 212th St. Preservation/Holcomb SP - 9 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 1. The Bidder submits a written request signed by an authorized person and physically delivers it to the place designated for receipt of Bid Proposals, and 2. The Contracting Agency receives the request before the time set for receipt of Bid Proposals, and 3. The revised or supplemented Bid Proposal (if any) is received by the Contracting Agency before the time set for receipt of Bid Proposals. If the Bidder’s request to withdraw, revise, or supplement its Bid Proposal is received before the time set for receipt of Bid Proposals, the Contracting Agency will return the unopened Proposal package to the Bidder. The Bidder must then submit the revised or supplemented package in its entirety. If the Bidder does not submit a revised or supplemented package, then its bid shall be considered withdrawn. Late revised or supplemented Bid Proposals or late withdrawal requests will be date recorded by the Contracting Agency and returned unopened. Mailed, emailed, or faxed requests to withdraw, revise, or supplement a Bid Proposal are not acceptable. SECTION 1-02.11 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-02.13 Irregular Proposals (October 1, 2020 APWA GSP) Delete this section and replace it with the following: 1. A Proposal will be considered irregular and will be rejected if: a. The Bidder is not prequalified when so required; b. The authorized Proposal form furnished by the Contracting Agency is not used or is altered; c. The completed Proposal form contains any unauthorized additions, deletions, alternate Bids, or conditions; d. The Bidder adds provisions reserving the right to reject or accept the award, or enter into the Contract; e. A price per unit cannot be determined from the Bid Proposal; f. The Proposal form is not properly executed; g. The Bidder fails to submit or properly complete a Subcontractor list, if applicable, as required in Section 1-02.6; h. The Bidder fails to submit or properly complete a Disadvantaged Business Enterprise Certification, if applicable, as required in Section 1-02.6; i. The Bidder fails to submit written confirmation from each DBE firm listed on the Bidder’s completed DBE Utilization Certification that they are in agreement with the bidder’s DBE participation commitment, if applicable, as required in Section 1-02.6, or if the written confirmation that is submitted fails to meet the requirements of the Special Provisions; j The Bidder fails to submit DBE Good Faith Effort documentation, if applicable, as required in Section 1-02.6, or if the documentation that is 212th St. Preservation/Holcomb SP - 10 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 submitted fails to demonstrate that a Good Faith Effort to meet the Condition of Award was made; k. The Bidder fails to submit a DBE Bid Item Breakdown form, if applicable, as required in Section 1-02.6, or if the documentation that is submitted fails to meet the requirements of the Special Provisions; l. The Bidder fails to submit DBE Trucking Credit Forms, if applicable, as required in Section 1-02.6, or if the documentation that is submitted fails to meet the requirements of the Special Provisions; m. The Bid Proposal does not constitute a definite and unqualified offer to meet the material terms of the Bid invitation; or n. More than one Proposal is submitted for the same project from a Bidder under the same or different names. 2. A Proposal may be considered irregular and may be rejected if: a. The Proposal does not include a unit price for every Bid item; b. Any of the unit prices are excessively unbalanced (either above or below the amount of a reasonable Bid) to the potential detriment of the Contracting Agency; c. Receipt of Addenda is not acknowledged; d. A member of a joint venture or partnership and the joint venture or partnership submit Proposals for the same project (in such an instance, both Bids may be rejected); or e. If Proposal form entries are not made in ink. 1-02.14 Disqualification of Bidders (May 17, 2018 APWA GSP, Option A) Delete this section and replace it with the following: A Bidder will be deemed not responsible if the Bidder does not meet the mandatory bidder responsibility criteria in RCW 39.04.350(1), as amended. The Contracting Agency will verify that the Bidder meets the mandatory bidder responsibility criteria in RCW 39.04.350(1). To assess bidder responsibility, the Contracting Agency reserves the right to request documentation as needed from the Bidder and third parties concerning the Bidder’s compliance with the mandatory bidder responsibility criteria. If the Contracting Agency determines the Bidder does not meet the mandatory bidder responsibility criteria in RCW 39.04.350(1) and is therefore not a responsible Bidder, the Contracting Agency shall notify the Bidder in writing, with the reasons for its determination. If the Bidder disagrees with this determination, it may appeal the determination within two (2) business days of the Contracting Agency’s determination by presenting its appeal and any additional information to the Contracting Agency. The Contracting Agency will consider the appeal and any additional information before issuing its final determination. If the final determination affirms that the Bidder is not responsible, the Contracting Agency will not execute a contract with any other Bidder until at least two business days after the Bidder determined to be not responsible has received the Contracting Agency’s final determination. 212th St. Preservation/Holcomb SP - 11 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 1-03 AWARD AND EXECUTION OF CONTRACT SECTION 1-03.1 IS REVISED BY INSERTING THE FOLLOWING PARAGRAPH AFTER THE SECOND PARAGRAPH IN THAT SECTION: (******) 1-03.1(1) Identical Bid Totals (January 4, 2016 APWA GSP) Revise this section to read: After opening Bids, if two or more lowest responsive Bid totals are exactly equal, then the tie-breaker will be the Bidder with an equal lowest bid, that proposed to use the highest percentage of recycled materials in the Project, per the form submitted with the Bid Proposal. If those percentages are also exactly equal, then the tie-breaker will be determined by drawing as follows: Two or more slips of paper will be marked as follows: one marked “Winner” and the other(s) marked “unsuccessful”. The slips will be folded to make the marking unseen. The slips will be placed inside a box. One authorized representative of each Bidder shall draw a slip from the box. Bidders shall draw in alphabetic order by the name of the firm as registered with the Washington State Department of Licensing. The slips shall be unfolded and the firm with the slip marked “Winner” will be determined to be the successful Bidder and eligible for Award of the Contract. Only those Bidders who submitted a Bid total that is exactly equal to the lowest responsive Bid, and with a proposed recycled materials percentage that is exactly equal to the highest proposed recycled materials amount, are eligible to draw. 1-03.7 Judicial Review (November 30, 2018 APWA GSP) Revise this section to read: Any decision made by the Contracting Agency regarding the Award and execution of the Contract or Bid rejection shall be conclusive subject to the scope of judicial review permitted under Washington Law. Such review, if any, shall be timely filed in the Superior Court of the county where the Contracting Agency headquarters is located, provided that where an action is asserted against a county, RCW 36.01.050 shall control venue and jurisdiction. 1-04 SCOPE OF THE WORK 1-04.2 Coordination of Contract Documents, Plans, Special Provisions, Specifications, and Addenda (December 10, 2020 APWA GSP) Revise the second paragraph to read: Any inconsistency in the parts of the contract shall be resolved by following this order of precedence (e.g., 1 presiding over 2, 2 over 3, 3 over 4, and so forth): 1. Addenda, 212th St. Preservation/Holcomb SP - 12 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 2. Proposal Form, 3. Special Provisions, 4. Contract Plans, 5. Standard Specifications, 6. Contracting Agency’s Standard Plans or Details (if any), and 7. WSDOT Standard Plans for Road, Bridge, and Municipal Construction. SECTION 1-04.9 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-04.9 Use of Private Properties (Kent Special Provision) Staging and storage locations needed for the Project must be properly permitted for that use. Limits of construction are indicated or defined on the plans and shall not extend beyond City right-of-way or easements. The Contractor shall confine all construction activities within these limits. If a staging and storage area is shown on the plans, the City will obtain all permits and approvals necessary for the Contractor’s use. If the Contractor selects its own staging and storage area(s), it is the Contractor’s sole responsibility to obtain all necessary permits/approvals to use the private property, specifically including, without limitation, all permits or approvals subject to State Environmental Policy Act, Shoreline Management Act, and critical areas regulations. Before using any other property as a staging or storage area (or for any other use), the Contractor shall thoroughly investigate the property for the presence of critical areas, buffers of critical areas, or other regulatory restrictions as defined in Kent City Code, county, state or federal regulations, and the Contractor shall provide the City written documentation that the property is not subject to other regulatory requirements or that the Contractor has obtained all necessary rights of entry, permits and approvals needed to use the property as the Contractor intends. Upon vacating the private property, the Contractor shall provide the City written verification that it has obtained all releases and/or performed all mitigation work as required by the conditions of the permit/approval and/or agreement with the property owner. The Contractor shall not be entitled to additional compensation or an extension of the time of completion of the Contractor for any work associated with the permitting, mitigation or use of private property. SECTION 1-04.11 ITEM 2 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-04.11 Final Cleanup (Kent Special Provision) 212th St. Preservation/Holcomb SP - 13 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 2. Remove from the project all unapproved and/or unneeded material left from grading, surfacing, paving, or temporary erosion control measures. 1-05 CONTROL OF WORK SECTION 1-05.3 IS SUPPLEMENTED WITH THE FOLLOWING: 1-05.3 Working Drawings (September 3, 2019 WSDOT GSP Option 1 ) When submittals require review by the railroad, the Engineer will require up to 60 calendar days from the date the submittals are received until they are returned to the Contractor. If a submittal is returned unapproved and then resubmitted, then an additional review time of up to 60 calendar days will be required. If more than 60 calendar days are required for the Engineer's review of an individual submittal or resubmittal, an extension of time will be considered in accordance with Section 1-08.8. SECTION 1-05.7 IS SUPPLEMENTED WITH THE FOLLOWING: (******) 1-05.7 Removal of Defective and Unauthorized Work (October 1, 2005 APWA GSP) Supplement this section with the following: If the Contractor fails to remedy defective or unauthorized work within the time specified in a written notice from the Engineer, or fails to perform any part of the work required by the Contract Documents, the Engineer may correct and remedy such work as may be identified in the written notice, with Contracting Agency forces or by such other means as the Contracting Agency may deem necessary. If the Contractor fails to comply with a written order to remedy what the Engineer determines to be an emergency situation, the Engineer may have the defective and unauthorized work corrected immediately, have the rejected work removed and replaced, or have work the Contractor refuses to perform completed by using Contracting Agency or other forces. An emergency situation is any situation when, in the opinion of the Engineer, a delay in its remedy could be potentially unsafe, or might cause serious risk of loss or damage to the public. Direct or indirect costs incurred by the Contracting Agency attributable to correcting and remedying defective or unauthorized work, or work the Contractor failed or refused to perform, shall be paid by the Contractor. Payment will be deducted by the Engineer from monies due, or to become due, the Contractor. Such direct and indirect costs shall include in particular, but without limitation, compensation for additional professional services required, and costs for repair and replacement of work of others destroyed or damaged by correction, removal, or replacement of the Contractor’s unauthorized work. No adjustment in contract time or compensation will be allowed because of the 212th St. Preservation/Holcomb SP - 14 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 delay in the performance of the work attributable to the exercise of the Contracting Agency’s rights provided by this Section. The rights exercised under the provisions of this section shall not diminish the Contracting Agency’s right to pursue any other avenue for additional remedy or damages with respect to the Contractor’s failure to perform the work as required. 1-05.11 Final Inspection Delete this section and replace it with the following: 1-05.11 Final Inspections and Operational Testing (October 1, 2005 APWA GSP) 1-05.11(1) Substantial Completion Date When the Contractor considers the work to be substantially complete, the Contractor shall so notify the Engineer and request the Engineer establish the Substantial Completion Date. The Contractor’s request shall list the specific items of work that remain to be completed in order to reach physical completion. The Engineer will schedule an inspection of the work with the Contractor to determine the status of completion. The Engineer may also establish the Substantial Completion Date unilaterally. If, after this inspection, the Engineer concurs with the Contractor that the work is substantially complete and ready for its intended use, the Engineer, by written notice to the Contractor, will set the Substantial Completion Date. If, after this inspection the Engineer does not consider the work substantially complete and ready for its intended use, the Engineer will, by written notice, so notify the Contractor giving the reasons therefor. Upon receipt of written notice concurring in or denying substantial completion, whichever is applicable, the Contractor shall pursue vigorously, diligently and without unauthorized interruption, the work necessary to reach Substantial and Physical Completion. The Contractor shall provide the Engineer with a revised schedule indicating when the Contractor expects to reach substantial and physical completion of the work. The above process shall be repeated until the Engineer establishes the Substantial Completion Date and the Contractor considers the work physically complete and ready for final inspection. 1-05.11(2) Final Inspection and Physical Completion Date When the Contractor considers the work physically complete and ready for final inspection, the Contractor by written notice, shall request the Engineer to schedule a final inspection. The Engineer will set a date for final inspection. The Engineer and the Contractor will then make a final inspection and the Engineer will notify the Contractor in writing of all particulars in which the final inspection reveals the work incomplete or unacceptable. The Contractor shall immediately take such corrective measures as are necessary to remedy the listed deficiencies. Corrective work shall be pursued vigorously, diligently, and without interruption until physical completion 212th St. Preservation/Holcomb SP - 15 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 of the listed deficiencies. This process will continue until the Engineer is satisfied the listed deficiencies have been corrected. If action to correct the listed deficiencies is not initiated within 7 days after receipt of the written notice listing the deficiencies, the Engineer may, upon written notice to the Contractor, take whatever steps are necessary to correct those deficiencies pursuant to Section 1-05.7. The Contractor will not be allowed an extension of contract time because of a delay in the performance of the work attributable to the exercise of the Engineer’s right hereunder. Upon correction of all deficiencies, the Engineer will notify the Contractor and the Contracting Agency, in writing, of the date upon which the work was considered physically complete. That date shall constitute the Physical Completion Date of the contract, but shall not imply acceptance of the work or that all the obligations of the Contractor under the contract have been fulfilled. 1-05.11(3) Operational Testing It is the intent of the Contracting Agency to have at the Physical Completion Date a complete and operable system. Therefore when the work involves the installation of machinery or other mechanical equipment; street lighting, electrical distribution or signal systems; irrigation systems; buildings; or other similar work it may be desirable for the Engineer to have the Contractor operate and test the work for a period of time after final inspection but prior to the physical completion date. Whenever items of work are listed in the Contract Provisions for operational testing they shall be fully tested under operating conditions for the time period specified to ensure their acceptability prior to the Physical Completion Date. During and following the test period, the Contractor shall correct any items of workmanship, materials, or equipment which prove faulty, or that are not in first class operating condition. Equipment, electrical controls, meters, or other devices and equipment to be tested during this period shall be tested under the observation of the Engineer, so that the Engineer may determine their suitability for the purpose for which they were installed. The Physical Completion Date cannot be established until testing and corrections have been completed to the satisfaction of the Engineer. The costs for power, gas, labor, material, supplies, and everything else needed to successfully complete operational testing, shall be included in the unit contract prices related to the system being tested, unless specifically set forth otherwise in the proposal. Operational and test periods, when required by the Engineer, shall not affect a manufacturer’s guaranties or warranties furnished under the terms of the contract. SECTION 1-05.13 IS REVISED BY INSERTING THE FOLLOWING PARAGRAPH AFTER THE FIRST PARAGRAPH: (******) 1-05.13 Superintendents, Labor, and Equipment of Contractor (Kent Special Provisions) 212th St. Preservation/Holcomb SP - 16 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Within ten (10) days of contract award, the Contractor shall designate the Contractor's project manager and superintendent for the contract work. SECTION 1-05.14 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 1-05.14 Cooperation With Other Contractors (Kent Special Provision) Details of known projects are as follow: City Projects S. 228th St. Grade Separation at Union Pacific Railroad The City of Kent is constructing a grade separation at the Union Pacific Railroad crossing. The City has closed S. 228th Street for the duration of the project. Construction is underway and is expected to be completed in early-2021. 76th Ave. S. Road Raising The City of Kent is raising the grade of 76th Ave S. This project will tie into the southern limits of the overlay on 76th Ave S. Lane closures on 76th Ave. S. should be anticipated. Construction on this project is underway and substantial completion is anticipated in January or February 2021. Other Contracts or Other Work PSE gas valves located within the overlay limits will be lowered prior to grinding and raised after paving at the cost of PSE and are not included in this contract. There is a private development construction project on the PSE owned property east of the BNSF railroad tracks on the south side of 212th Street. The contractor shall coordinate all work, including the driveway and sidewalk replacement work, in front of the PSE owned property with the City’s Private Development Inspector, David Devine (253-261-5048). The contractor shall notify the Engineer a minimum of 5 working days prior to starting this work. SECTION 1-05 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTIONS: 1-05.16 Water and Power (October 1, 2005 APWA GSP) The Contractor shall make necessary arrangements, and shall bear the costs for power and water necessary for the performance of the work, unless the contract includes power and water as a pay item. (******) 1-05.17 Oral Agreements (Kent Special Provision) New Section 212th St. Preservation/Holcomb SP - 17 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 No oral agreement or conversation with any officer, agent, or employee of the City, either before or after execution of the contract, shall affect or modify the terms or obligations contained in any of the documents comprising the contract. Such oral agreement or conversation shall be considered unofficial information and in no way binding upon the City, unless subsequently recorded and/or put in writing. 1-05.18 Referencing Existing Pavement Markings (Kent Special Provision) New Section The Contractor shall be responsible for referencing and documenting all existing pavement markings. The Contractor's referencing plans shall indicate reference points and offsets taken at consistent intervals sufficient to restore all pavement markings to original configuration within two inches unless otherwise noted on the plans. The Contractor shall demonstrate to the Engineer that referencing has been accomplished prior to performing any work which will remove or cover the existing markings. The Contractor shall also be responsible for laying out all temporary and permanent pavement markings to the existing locations or in modified locations as shown in the plans or directed by engineer. Pavement markings shall be replaced using the materials called for in these Specifications. 1-06 CONTROL OF MATERIAL Section 1-06 is supplemented with the following: Buy America (August 6, 2012 WSDOT GSP) In accordance with Buy America requirements contained in 23 CFR 635.410, the major quantities of steel and iron construction material that is permanently incorporated into the project shall consist of American-made materials only. Buy America does not apply to temporary steel items, e.g., temporary sheet piling, temporary bridges, steel scaffolding and falsework. Minor amounts of foreign steel and iron may be utilized in this project provided the cost of the foreign material used does not exceed one-tenth of one percent of the total contract cost or $2,500.00, whichever is greater. American-made material is defined as material having all manufacturing processes occurring domestically. To further define the coverage, a domestic product is a manufactured steel material that was produced in one of the 50 States, the District of Columbia, Puerto Rico, or in the territories and possessions of the United States. If domestically produced steel billets or iron ingots are exported outside of the area of coverage, as defined above, for any manufacturing process then the resulting product does not conform to the Buy America requirements. Additionally, products manufactured domestically from foreign source steel billets or iron ingots do not conform to the Buy America requirements because 212th St. Preservation/Holcomb SP - 18 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 the initial melting and mixing of alloys to create the material occurred in a foreign country. Manufacturing begins with the initial melting and mixing, and continues through the coating stage. Any process which modifies the chemical content, the physical size or shape, or the final finish is considered a manufacturing process. The processes include rolling, extruding, machining, bending, grinding, drilling, welding, and coating. The action of applying a coating to steel or iron is deemed a manufacturing process. Coating includes epoxy coating, galvanizing, aluminizing, painting, and any other coating that protects or enhances the value of steel or iron. Any process from the original reduction from ore to the finished product constitutes a manufacturing process for iron. Due to a nationwide waiver, Buy America does not apply to raw materials (iron ore and alloys), scrap (recycled steel or iron), and pig iron or processed, pelletized, and reduced iron ore. The following are considered to be steel manufacturing processes: 1. Production of steel by any of the following processes: a. Open hearth furnace. b. Basic oxygen. c. Electric furnace. d. Direct reduction. 2. Rolling, heat treating, and any other similar processing. 3. Fabrication of the products. 52 06051. a. Spinning wire into cable or strand. b. Corrugating and rolling into culverts. c. Shop fabrication. A certification of materials origin will be required for any items comprised of, or containing, steel or iron construction materials prior to such items being incorporated into the permanent work. The certification shall be on DOT Form 350-109EF provided by the Engineer, or such other form the Contractor chooses, provided it contains the same information as DOT Form 350-109EF. 1 -0 6.6 Recycled Materials (January 4, 2016 APWA GSP) Delete this section, including its subsections, and replace it with the following: 212th St. Preservation/Holcomb SP - 19 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Contractor shall make their best effort to utilize recycled materials in the construction of the project. Approval of such material use shall be as detailed elsewhere in the Standard Specifications. Prior to Physical Completion the Contractor shall report the quantity of recycled materials that were utilized in the construction of the project for each of the items listed in Section 9-03.21. The report shall include hot mix asphalt, recycled concrete aggregate, recycled glass, steel furnace slag and other recycled materials (e.g. utilization of on-site material and aggregates from concrete returned to the supplier). The Contractor’s report shall be provided on DOT form 350-075 Recycled Materials Reporting. 1-07 LEGAL RELATIONS AND RESPONSIBILITIES TO THE PUBLIC 1-07.2 State Taxes Delete this section, including its sub-sections, in its entirety and replace it with the following: 1-07.2 State Sales Tax (June 27, 2011 APWA GSP) The Washington State Department of Revenue has issued special rules on the State sales tax. Sections 1-07.2(1) through 1-07.2(3) are meant to clarify those rules. The Contractor should contact the Washington State Department of Revenue for answers to questions in this area. The Contracting Agency will not adjust its payment if the Contractor bases a bid on a misunderstood tax liability. The Contractor shall include all Contractor-paid taxes in the unit bid prices or other contract amounts. In some cases, however, state retail sales tax will not be included. Section 1-07.2(2) describes this exception. The Contracting Agency will pay the retained percentage (or release the Contract Bond if a FHWA-funded Project) only if the Contractor has obtained from the Washington State Department of Revenue a certificate showing that all contract- related taxes have been paid (RCW 60.28.051). The Contracting Agency may deduct from its payments to the Contractor any amount the Contractor may owe the Washington State Department of Revenue, whether the amount owed relates to this contract or not. Any amount so deducted will be paid into the proper State fund. 1-07.2(1) State Sales Tax — Rule 171 WAC 458-20-171, and its related rules, apply to building, repairing, or improving streets, roads, etc., which are owned by a municipal corporation, or political subdivision of the state, or by the United States, and which are used primarily for foot or vehicular traffic. This includes storm or combined sewer systems within and included as a part of the street or road drainage system and power lines when such are part of the roadway lighting system. For work performed in such cases, the Contractor shall include Washington State Retail Sales Taxes in the various unit bid item prices, or other contract amounts, including those that the Contractor pays on the purchase of the materials, equipment, or supplies used or consumed in 212th St. Preservation/Holcomb SP - 20 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 doing the work. 1-07.2(2) State Sales Tax — Rule 170 WAC 458-20-170, and its related rules, apply to the constructing and repairing of new or existing buildings, or other structures, upon real property. This includes, but is not limited to, the construction of streets, roads, highways, etc., owned by the state of Washington; water mains and their appurtenances; sanitary sewers and sewage disposal systems unless such sewers and disposal systems are within, and a part of, a street or road drainage system; telephone, telegraph, electrical power distribution lines, or other conduits or lines in or above streets or roads, unless such power lines become a part of a street or road lighting system; and installing or attaching of any article of tangible personal property in or to real property, whether or not such personal property becomes a part of the realty by virtue of installation. For work performed in such cases, the Contractor shall collect from the Contracting Agency, retail sales tax on the full contract price. The Contracting Agency will automatically add this sales tax to each payment to the Contractor. For this reason, the Contractor shall not include the retail sales tax in the unit bid item prices, or in any other contract amount subject to Rule 170, with the following exception. Exception: The Contracting Agency will not add in sales tax for a payment the Contractor or a subcontractor makes on the purchase or rental of tools, machinery, equipment, or consumable supplies not integrated into the project. Such sales taxes shall be included in the unit bid item prices or in any other contract amount. 1-07.2(3) Services The Contractor shall not collect retail sales tax from the Contracting Agency on any contract wholly for professional or other services (as defined in Washington State Department of Revenue Rules 138 and 244). 1-07.4 Sanitation Health Hazards Section 1-07.4(2) is supplemented with the following: (May 13, 2020) COVID-19 Health and Safety Plan (CHSP) The Contractor shall prepare a project specific COVID-19 health and safety plan (CHSP). The CHSP shall be prepared and submitted as a Type 2 Working Drawing prior to beginning physical Work. The CHSP shall be based on the most current State and Federal requirements. If the State or Federal requirements are revised, the CHSP shall be updated as necessary to conform to the current requirements. The Contractor shall update and resubmit the CHSP as the work progresses and new activities appear on the look ahead schedule required under Section 1-08.3(2)D. If the conditions change on the project, or a particular activity, the Contractor shall update and resubmit the CHSP. 212th St. Preservation/Holcomb SP - 21 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Work on any activity shall cease if conditions prevent full compliance with the CHSP. The CHSP shall address the health and safety of all people associated with the project including State workers in the field, Contractor personnel, consultants, project staff, subcontractors, suppliers and anyone on the project site, staging areas, or yards. COVID-19 Health and Safety Plan (CHSP) Inspection The Contractor shall grant full and unrestricted access to the Engineer for CHSP Inspections. The Engineer (or designee) will conduct periodic compliance inspections on the project site, staging areas, or yards to verify that any ongoing work activity is following the CHSP plan. If the Engineer becomes aware of a noncompliance incident either through a site inspection or other means, the Contractor will be notified immediately (within 1 hour). The Contractor shall immediately remedy the noncompliance incident or suspend all or part of the associated work activity. The Contractor shall satisfy the Engineer that the noncompliance incident has been corrected before the suspension will end. SECTION 1-07.4(2) IS DELETED AND REPLACED WITH THE FOLLOWING: 1-07.4(2) COVID-19 Job Site Requirements Before commencing any work on the Project site, the Contractor shall develop and post at each job site a comprehensive COVID-19 exposure control, mitigation, and recovery plan that complies with the Phase 1 Construction Restart COVID-19 Job Site Requirements issued by the Governor, or subsequent modifications or phase amendments as the Governor may issue. Contractor must further meet and maintain all requirements of the plan, including providing materials, schedules, and equipment required to comply with those job site requirements or any future adjustments that may be made to job site requirements by the Governor or any applicable federal or state agency during the COVID-19 emergency. A copy of the COVID-19 job site safety plan, along with the identification and contact information for the COVID-19 Supervisor, shall be provided to the Engineer. SECTION 1-07.6 IS SUPPLEMENTED BY INSERTING THE FOLLOWING PARAGRAPH BEFORE THE FIRST PARAGRAPH: (******) 1-07.6 Permits and Licenses (Kent Special Provision) The City has obtained the following: SEPA Exemption NEPA Categorical Exclusion City of Kent Noise Ordinance Exemption 212th St. Preservation/Holcomb SP - 22 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 To be completed by Contractor (see Appendices for Draft Agreements): Union Pacific’s – Contractor’s Right of Entry Agreement BNSF – Roadway Surfacing Agreement (******) SECTION 1-07.6 IS SUPPLEMENTED BY INSERTING THE FOLLOWING PARAGRAPHS AFTER THE LAST PARAGRAPH: A copy of each permit and/or license obtained by the Contractor shall be furnished to the City. Approved permits shall be furnished to the City upon completion of the project and prior to final acceptance. The Contractor shall promptly notify the City in writing of any variance in the contract work arising from the issuance of any permit. Load Limits SECTION 1-07.7 IS SUPPLEMENTED WITH THE FOLLOWING: (March 13, 1995) If the sources of materials provided by the Contractor necessitates hauling over roads other than State Highways, the Contractor shall, at the Contractor's expense, make all arrangements for the use of the haul routes. 1-07.9 Wages 1-07.9(1) General Section 1-07.9(1) is supplemented with the following: 1-07.9(1) (January 6, 2020 WSDOT GSP) The Federal wage rates incorporated in this contract have been established by the 43 Secretary of Labor under United States Department of Labor General Decision No. WA20200001. The State rates incorporated in this contract are applicable to all construction activities associated with this contract. (April 2, 2007 WSDOT GSP) Application of Wage Rates for the Occupation of Landscape Construction State prevailing wage rates for public works contracts are included in this contract and show a separate listing for the occupation: Landscape Construction, which includes several different occupation descriptions such as: Irrigation and Landscape Plumbers, Irrigation and Landscape Power Equipment Operators, and Landscaping or Planting 212th St. Preservation/Holcomb SP - 23 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Laborers. In addition, federal wage rates that are included in this contract may also include occupation descriptions in Federal Occupational groups for work also specifically identified with landscaping such as: Laborers with the occupation description, Landscaping or Planting, or Power Equipment Operators with the occupation description, Mulch Seeding Operator. If Federal wage rates include one or more rates specified as applicable to landscaping work, then Federal wage rates for all occupation descriptions, specific or general, must be considered and compared with corresponding State wage rates. The higher wage rate, either State or Federal, becomes the minimum wage rate for the work performed in that occupation. Contractors are responsible for determining the appropriate crafts necessary to perform the contract work. If a classification considered necessary for performance of the work is missing from the Federal Wage Determination applicable to the contract, the Contractor shall initiate a request for approval of a proposed wage and benefit rate. The Contractor shall prepare and submit Standard Form 1444, request for Authorization of Additional Classification and Wage Rate available at http://www.wdol.gov/docs/sf1444.pdf, and submit the completed form to the Engineer’s office. The presence of a classification wage on the Washington State Prevailing Wage Rates For Public Works Contracts does not exempt the use of form 1444 for the purpose of determining a federal classification wage rate. 1-07.9(5) Required Documents (January 3, 2020 APWA GSP) Delete this section and replace it with the following: General All “Statements of Intent to Pay Prevailing Wages”, “Affidavits of Wages Paid” and Certified Payrolls, including a signed Statement of Compliance for Federal-aid projects, shall be submitted to the Engineer and the State L&I online Prevailing Wage Intent & Affidavit (PWIA) system. Intents and Affidavits On forms provided by the Industrial Statistician of State L&I, the Contractor shall submit to the Engineer the following for themselves and for each firm covered under RCW 39.12 that will or has provided Work and materials for the Contract: 1. The approved “Statement of Intent to Pay Prevailing Wages” State L&I’s form number F700-029-000. The Contracting Agency will make no payment under this Contract until this statement has been approved by State L&I and reviewed by the Engineer. 2. The approved “Affidavit of Prevailing Wages Paid”, State L&I’s form number F700-007-000. The Contracting Agency will not grant Completion until all 212th St. Preservation/Holcomb SP - 24 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 approved Affidavit of Wages paid for the Contractor and all Subcontractors have been received by the Engineer. The Contracting Agency will not release to the Contractor any funds retained under RCW 60.28.011 until “Affidavit of Prevailing Wages Paid” forms have been approved by State L&I and all of the approved forms have been submitted to the Engineer for every firm that worked on the Contract. The Contractor is responsible for requesting these forms from State L&I and for paying any fees required by State L&I. Certified Payrolls Certified payrolls are required to be submitted by the Contractor for themselves, all Subcontractors and all lower tier subcontractors. The payrolls shall be submitted weekly on all Federal-aid projects and no less than monthly on State funded projects. Penalties for Noncompliance The Contractor is advised, if these payrolls are not supplied within the prescribed deadlines, any or all payments may be withheld until compliance is achieved. In addition, failure to provide these payrolls may result in other sanctions as provided by State laws (RCW 39.12.050) and/or Federal regulations (29 CFR 5.12). 1-07.11 Requirements for Nondiscrimination (October 1, 2020 APWA GSP, Option B) Supplement this section with the following: Disadvantaged Business Enterprise Participation The Disadvantaged Business Enterprise (DBE) requirements of 49 CFR Part 26 and USDOT’s official interpretations (i.e., Questions & Answers) apply to this Contract. Demonstrating compliance with these Specifications is a Condition of Award (COA) of this Contract. Failure to comply with the requirements of this Specification may result in your Bid being found to be nonresponsive resulting in rejection or other sanctions as provided by Contract. DBE Abbreviations and Definitions Broker – A business firm that provides a bona fide service, such as professional, technical, consultant or managerial services and assistance in the procurement of essential personnel, facilities, equipment, materials, or supplies required for the performance of the Contract; or, persons/companies who arrange or expedite transactions. Certified Business Description – Specific descriptions of work the DBE is certified to perform, as identified in the Certified Firm Directory, under the Vendor Information page. Certified Firm Directory – A database of all Minority, Women, and Disadvantaged Business Enterprises currently certified by Washington State. The on-line Directory is available to Bidders for their use in identifying and soliciting interest from DBE firms. The database is located under the Firm Certification section of the Diversity Management and Compliance System web page at: https://omwbe.diversitycompliance.com. 212th St. Preservation/Holcomb SP - 25 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Commercially Useful Function (CUF) – 49 CFR 26.55(c)(1) defines commercially useful function as: “A DBE performs a commercially useful function when it is responsible for execution of the work of the contract and is carrying out its responsibilities by actually performing, managing, and supervising the work involved. To perform a commercially useful function, the DBE must also be responsible, with respect to materials and supplies used on the contract, for negotiating price, determining quality and quantity, ordering the material, and installing (where applicable) and paying for the material itself. To determine whether a DBE is performing a commercially useful function, you must evaluate the amount of work subcontracted, industry practices, whether the amount the firm is to be paid under the contract is commensurate with the work it is actually performing and the DBE credit claimed for its performance of the work, and other relevant factors.” Disadvantaged Business Enterprise (DBE) – A business firm certified by the Washington State Office of Minority and Women’s Business Enterprises, as meeting the criteria outlined in 49 CFR 26 regarding DBE certification. Force Account Work – Work measured and paid in accordance with Section 1-09.6. Good Faith Efforts – Efforts to achieve the DBE COA Goal or other requirements of this part which, by their scope, intensity, and appropriateness to the objective, can reasonably be expected to fulfill the program requirement. Manufacturer (DBE) – A DBE firm that operates or maintains a factory or establishment that produces on the premises the materials, supplies, articles, or equipment required under the Contract. A DBE Manufacturer shall produce finished goods or products from raw or unfinished material or purchase and substantially alters goods and materials to make them suitable for construction use before reselling them. Reasonable Fee (DBE) – For purposes of Brokers or service providers a reasonable fee shall not exceed 5% of the total cost of the goods or services brokered. Regular Dealer (DBE) – A DBE firm that owns, operates, or maintains a store, warehouse, or other establishment in which the materials or supplies required for the performance of a Contract are bought, kept in stock, and regularly sold to the public in the usual course of business. To be a Regular Dealer, the DBE firm must be an established regular business that engages in as its principal business and in its own name the purchase and sale of the products in question. A Regular Dealer in such items as steel, cement, gravel, stone, and petroleum products need not own, operate or maintain a place of business if it both owns and operates distribution equipment for the products. Any supplementing of regular dealers’ own distribution equipment shall be by long-term formal lease agreements and not on an ad-hoc basis. Brokers, packagers, 212th St. Preservation/Holcomb SP - 26 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 manufacturers’ representatives, or other persons who arrange or expedite transactions shall not be regarded as Regular Dealers within the meaning of this definition. DBE Commitment – The scope of work and dollar amount the Bidder indicates they will be subcontracting to be applied towards the DBE Condition of Award Goal as shown on the DBE Utilization Certification Form for each DBE Subcontractor. This DBE Commitment amount will be incorporated into the Contract and shall be considered a Contract requirement. The Contractor shall utilize the COA DBEs to perform the work and supply the materials for which they are committed. Any changes to the DBE Commitment require the Engineer’s prior written approval. DBE Condition of Award (COA) Goal – An assigned numerical amount specified as a percentage of the Contract. Initially, this is the minimum amount that the Bidder must commit to by submission of the Utilization Certification Form and/or by Good Faith Effort (GFE). DBE COA Goal The Contracting Agency has established a DBE COA Goal for this Contract in the amount of: 18% Crediting DBE Participation Subcontractors proposed as COA must be certified prior to the due date for bids on the Contract. All non-COA DBE Subcontractors shall be certified before the subcontract on which they are participating is executed. DBE participation is only credited upon payment to the DBE. The following are some definitions of what may be counted as DBE participation. DBE Prime Contractor Only take credit for that portion of the total dollar value of the Contract equal to the distinct, clearly defined portion of the Work that the DBE Prime Contractor performs with its own forces and is certified to perform. DBE Subcontractor Only take credit for that portion of the total dollar value of the subcontract that is equal to the distinct, clearly defined portion of the Work that the DBE performs with its own forces and is certified to perform. The value of work performed by the DBE includes the cost of supplies and materials purchased by the DBE and equipment leased by the DBE, for its work on the contract. Supplies, materials or equipment obtained by a DBE that are not utilized or incorporated in the contract work by the DBE will not be eligible for DBE credit. The supplies, materials, and equipment purchased or leased from the Contractor or its affiliate, including any Contractor’s resources available to DBE subcontractors at no cost, shall not be credited. 212th St. Preservation/Holcomb SP - 27 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DBE credit will not be given in instances where the equipment lease includes the operator. The DBE is expected to operate the equipment used in the performance of its work under the contract with its own forces. Situations where equipment is leased and used by the DBE, but payment is deducted from the Contractor’s payment to the DBE is not allowed. When the subcontractor is part of a DBE Commitment, the following apply: 1. If a DBE subcontracts a portion of the Work of its contract to another firm, the value of the subcontracted Work may be counted toward the DBE COA Goal only if the Lower-Tier Subcontractor is also a DBE. 2. Work subcontracted to a Lower-Tier Subcontractor that is a DBE, may be counted toward the DBE COA Goal. 3. Work subcontracted to a non-DBE does not count towards the DBE COA Goal. DBE Subcontract and Lower Tier Subcontract Documents There must be a subcontract agreement that complies with 49 CFR Part 26 and fully describes the distinct elements of Work committed to be performed by the DBE. DBE Service Provider The value of fees or commissions charged by a DBE firm behaving in a manner of a Broker, or another service provider for providing a bona fide service, such as professional, technical, consultant, managerial services, or for providing bonds or insurance specifically required for the performance of the contract will only be credited as DBE participation, if the fee/commission is determined by the Contracting Agency to be reasonable and the firm has performed a CUF. Force Account Work When the Bidder elects to utilize force account Work to meet the DBE COA Goal, as demonstrated by listing this force account Work on the DBE Utilization Certification Form, for the purposes of meeting the DBE COA Goal, only 50% of the Proposal amount shall be credited toward the Bidder’s Commitment to meet the DBE COA Goal. One hundred percent of the actual amounts paid to the DBE for the force account Work shall be credited towards the DBE COA Goal or DBE participation. Temporary Traffic Control If the DBE firm only provides “Flagging”, the DBE firm must provide a Tr affic Control Supervisor (TCS) and flagger, which are under the direct control of the DBE. The DBE firm shall also provide all flagging equipment for it’s employees (e.g. paddles, hard hats, and vests). 212th St. Preservation/Holcomb SP - 28 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 If the DBE firm provides “Traffic Control Services”, the DBE firm must provide a TCS, flaggers, and traffic control items (e.g., cones, barrels, signs, etc.) and be in total control of all items in implementing the traffic control for the project. Trucking DBE trucking firm participation may only be credited as DBE participation for the value of the hauling services, not for the materials being hauled unless the trucking firm is also certified as a supplier of those materials. In situations where the DBE’s work is priced per ton, the value of the hauling service must be calculated separately from the value of the materials in order to determine DBE credit for hauling The DBE trucking firm must own and operate at least one licensed, insured and operational truck on the contract. The truck must be of the type that is necessary to perform the hauling duties required under the contract. The DBE receives credit for the value of the transportation services it provides on the Contract using trucks it owns or leases, licenses, insures, and operates with drivers it employs. The DBE may lease additional trucks from another DBE firm. The DBE who leases additional trucks from another DBE firm receives credit for the value of the transportation services the lessee DBE provides on the Contract. The trucking Work subcontracted to any non-DBE trucking firm will not receive credit for Work done on the project. The DBE may lease trucks from a truck leasing company (recognized truck rental center), but can only receive credit towards DBE participation if the DBE uses its own employees as drivers. DBE Manufacturer and DBE Regular Dealer One hundred percent (100%) of the cost of the manufactured product obtained from a DBE manufacturer may count towards the DBE COA Goal. Sixty percent (60%) of the cost of materials or supplies purchased from a DBE Regular Dealer may be credited towards the DBE Goal. If the role of the DBE Regular Dealer is determined to be that of a Broker, then DBE credit shall be limited to the fee or commission it receives for its services. Regular Dealer status and the amount of credit is determined on a Contract-by-Contract basis. DBE firms proposed to be used as a Regular Dealer must be approved before being listed as a COA/used on a project. The WSDOT Approved Regular Dealer list published on WSDOT’s Office of Equal Opportunity (OEO) web site must include the specific project for which approval is being requested. For purposes of the DBE COA Goal participation, the Regular Dealer must submit the Regular Dealer Status Request form a minimum of five calendar days prior to bid opening. 212th St. Preservation/Holcomb SP - 29 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Purchase of materials or supplies from a DBE which is neither a manufacturer nor a regular dealer, (i.e. Broker) only the fees or commissions charged for assistance in the procurement of the materials and supplies, or fees or transportation charges for the delivery of materials or supplies required on the job site, may count towards the DBE COA Goal provided the fees are not excessive as compared with fees customarily allowed for similar services. Documentation will be required to support the fee/commission charged by the DBE. The cost of the materials and supplies themselves cannot be counted toward the DBE COA Goal. Note: Requests to be listed as a Regular Dealer will only be processed if the requesting firm is a material supplier certified by the Office of Minority and Women’s Business Enterprises in a NAICS code that falls within the 42XXXX NAICS Wholesale code section. Disadvantaged Business Enterprise Utilization To be eligible for award of the Contract, the Bidder shall properly complete and submit a Disadvantaged Business Enterprise (DBE) Utilization Certification with the Bidder’s sealed Bid Proposal, as specified in Section 1-02.9 Delivery of Proposal. The Bidder’s DBE Utilization Certification must clearly demonstrate how the Bidder intends to meet the DBE COA Goal. A DBE Utilization Certification (WSDOT Form 272-056) is included in the Proposal package for this purpose as well as instructions on how to properly fill out the form. The Bidder is advised that the items listed below when listed in the Utilization Certification must have their amounts reduced to the percentages shown and those reduced amounts will be the amount applied towards meeting the DBE COA Goal. • Force account at 50% • Regular dealer at 60% In the event of arithmetic errors in completing the DBE Utilization Certification, the amount listed to be applied towards the DBE COA Goal for each DBE shall govern and the DBE total amount shall be adjusted accordingly. Note: The Contracting Agency shall consider as non-responsive and shall reject any Bid Proposal submitted that does not contain a DBE Utilization Certification Form that accurately demonstrates how the Bidder intends to meet the DBE COA Goal. Disadvantaged Business Enterprise Written Confirmation Document(s) The Bidder shall submit an Disadvantaged Business Enterprise (DBE) Written Confirmation Document (completed and signed by the DBE) for each DBE firm listed in the Bidder’s completed DBE Utilization Certification submitted with the Bid. Failure to do so will result in the associated participation being disallowed, which may cause the Bid to be determined to be nonresponsive resulting in Bid rejection. 212th St. Preservation/Holcomb SP - 30 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Confirmation Documents provide confirmation from the DBEs that they are participating in the Contract as provided in the Bidder’s Commitment. The Confirmation Documents must be consistent with the Utilization Certification. A DBE Written Confirmation Document (WSDOT Form 422-031) is included in the Proposal package for this purpose. The form(s) shall be received as specified in the special provisions for Section 1-02.9 Delivery of Proposal. It is prohibited for the Bidder to require a DBE to submit a Written Confirmation Document with any part of the form left blank. Should the Contracting Agency determine that an incomplete Written Confirmation Document was signed by a DBE, the validity of the document comes into question. The associated DBE participation may not receive credit. Selection of Successful Bidder/Good Faith Efforts (GFE) The successful Bidder shall be selected on the basis of having submitted the lowest responsive Bid, which demonstrates a good faith effort to achieve the DBE COA Goal. The Contracting Agency, at any time during the selection process, may request a breakdown of the bid items and amounts that are counted towards the overall contract goal for any of the DBEs listed on the DBE Utilization Certification. Achieving the DBE COA Goal may be accomplished in one of two ways: 1. By meeting the DBE COA Goal Submission of the DBE Utilization Certification, supporting DBE Written Confirmation Document(s) showing the Bidder has obtained enough DBE participation to meet or exceed the DBE COA Goal, the DBE Bid Item Breakdown and the DBE Trucking Credit Form, if applicable. 2. By documentation that the Bidder made adequate GFE to meet the DBE COA Goal The Bidder may demonstrate a GFE in whole or part through GFE documentation ONLY IN THE EVENT a Bidder’s efforts to solicit sufficient DBE participation have been unsuccessful. The Bidder must supply GFE documentation in addition to the DBE Utilization Certification, supporting DBE Written Confirmation Document(s), the DBE Bid Item Breakdown form and the DBE Trucking Credit Form, if applicable. Note: In the case where a Bidder is awarded the contract based on demonstrating adequate GFE, the advertised DBE COA Goal will not be reduced. The Bidder shall demonstrate a GFE during the life of the Contract to attain the advertised DBE COA Goal. GFE documentation, the DBE Bid Item Breakdown form, and the DBE Trucking Credit Form, if applicable, shall be submitted as specified in Section 1-02.9. The Contracting Agency will review the GFE documentation and will determine if the Bidder made an adequate good faith effort. 212th St. Preservation/Holcomb SP - 31 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Good Faith Effort (GFE) Documentation GFE is evaluated when: 1. Determining award of a Contract that has COA goal, 2. When a COA DBE is terminated and substitution is required, and 3. Prior to Physical Completion when determining whether the Contractor has satisfied its DBE commitments. 49 CFR Part 26, Appendix A is intended as general guidance and does not, in itself, demonstrate adequate good faith efforts. The following is a list of types of actions, which would be considered as part of the Bidder’s GFE to achieve DBE participation. It is not intended to be a mandatory checklist, nor is it intended to be exclusive or exhaustive. Other factors or types of efforts may be relevant in appropriate cases. 1. Soliciting through all reasonable and available means (e.g. attendance at pre-bid meetings, advertising and/or written notices) the interest of all certified DBEs who have the capability to perform the Work of the Contract. The Bidder must solicit this interest within sufficient time to allow the DBEs to respond to the solicitation. The Bidder must determine with certainty if the DBEs are interested by taking appropriate steps to follow up initial solicitations. 2. Selecting portions of the Work to be performed by DBEs in order to increase the likelihood that the DBE COA Goal will be achieved. This includes, where appropriate, breaking out contract Work items into economically feasible units to facilitate DBE participation, even when the Bidder might otherwise prefer to perform these Work items with its own forces. 3. Providing interested DBEs with adequate information about the Plans, Specifications, and requirements of the Contract in a timely manner to assist them in responding to a solicitation. a. Negotiating in good faith with interested DBEs. It is the Bidder’s responsibility to make a portion of the Work available to DBE subcontractors and suppliers and to select those portions of the Work or material needs consistent with the available DBE subcontractors and suppliers, so as to facilitate DBE participation. Evidence of such negotiation includes the names, addresses, and telephone numbers of DBEs that were considered; a description of the information provided regarding the Plans and Specifications for the Work selected for subcontracting; and evidence as to why additional agreements could not be reached for DBEs to perform the Work. b. A Bidder using good business judgment would consider a number of factors in negotiating with subcontractors, including DBE subcontractors, and would take a firm’s price and capabilities as 212th St. Preservation/Holcomb SP - 32 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 well as the DBE COA Goal into consideration. However, the fact that there may be some additional costs involved in finding and using DBEs is not in itself sufficient reason for a Bidder’s failure to meet the DBE COA Goal, as long as such costs are reasonable. Also, the ability or desire of a Bidder to perform the Work of a Contract with its own organization does not relieve the Bidder of the responsibility to make Good Faith Efforts. Bidders are not, however, required to accept higher quotes from DBEs if the price difference is excessive or unreasonable. 4. Not rejecting DBEs as being unqualified without sound reasons based on a thorough investigation of their capabilities. The Bidder’s standing within its industry, membership in specific groups, organizations, or associations and political or social affiliations (for example union vs. non-union employee status) are not legitimate causes for the rejection or non-solicitation of bids in the Bidder’s efforts to meet the DBE COA Goal. 5. Making efforts to assist interested DBEs in obtaining bonding, lines of credit, or insurance as required by the recipient or Bidder. 6. Making efforts to assist interested DBEs in obtaining necessary equipment, supplies, materials, or related assistance or services. 7. Effectively using the services of available minority/women community organizations; minority/women contractors’ groups; local, State, and Federal minority/women business assistance offices; and other organizations as allowed on a case-by-case basis to provide assistance in the recruitment and placement of DBEs. 8. Documentation of GFE must include copies of each DBE and non-DBE subcontractor quotes submitted to the Bidder when a non-DBE subcontractor is selected over a DBE for Work on the Contract. (ref. updated DBE regulations – 26.53(b)(2)(vi) & App. A) Administrative Reconsideration of GFE Documentation A Bidder has the right to request reconsideration if the GFE documentation submitted with their Bid was determined to be inadequate. • The Bidder must request within 48 hours of notification of being nonresponsive or forfeit the right to reconsideration. • The reconsideration decision on the adequacy of the Bidder’s GFE documentation shall be made by an official who did not take part in the original determination. • Only original GFE documentation submitted as a supplement to the Bid shall be considered. The Bidder shall not introduce new documentation at the reconsideration hearing. 212th St. Preservation/Holcomb SP - 33 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 • The Bidder shall have the opportunity to meet in person with the official for the purpose of setting forth the Bidder’s position as to why the GFE documentation demonstrates a sufficient effort. • The reconsideration official shall provide the Bidder with a written decision on reconsideration within five working days of the hearing explaining the basis for their finding. DBE Bid Item Breakdown The Bidder shall submit a DBE Bid Item Breakdown Form (WSDOT Form 272- 054) as specified in the Special Provisions for Section 1-02.9, Delivery of Proposal. DBE Trucking Credit Form The Bidder shall submit a DBE Trucking Credit Form (WSDOT Form 272-058), as specified in the Special Provisions for Section 1-02.9, Delivery of Proposal. Note: The DBE Trucking Credit Form is only required for a DBE Firm listed on the DBE Utilization Certification as a subcontractor for “Trucking” or “Hauling” and are performing a part of a bid item. For example, if the item of Work is Structure Excavation including Haul, and another firm is doing the excavation and the DBE Trucking firm is doing the haul, the form is required. For a DBE subcontractor that is responsible for an entire item of work that may require some use of trucks, the form is not required. Procedures between Award and Execution After Award and prior to Execution, the Contractor shall provide the additional information described below. Failure to comply shall result in the forfeiture of the Bidder’s Proposal bond or deposit. 1. A list of all firms who submitted a bid or quote in attempt to participate in this project whether they were successful or not. Include the business name and mailing address. Note: The firms identified by the Contractor may be contacted by the Contracting Agency to solicit general information as follows: age of the firm and average of its gross annual receipts over the past three years. Procedures after Execution Commercially Useful Function (CUF) The Contractor may only take credit for the payments made for Work performed by a DBE that is determined to be performing a CUF. Payment must be commensurate with the work actually performed by the DBE. This applies to all DBEs performing Work on a project, whether or not the DBEs are COA, if the Contractor wants to receive credit for their participation. The Engineer will conduct CUF reviews to ascertain whether DBEs are performing a CUF. A DBE performs a CUF when it is carrying out its responsibilities of its contract by actually performing, managing, and supervising the Wo rk involved. The DBE must be responsible for negotiating price; determining quality and quantity; ordering the material, 212th St. Preservation/Holcomb SP - 34 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 installing (where applicable); and paying for the material itself. If a DBE does not perform “all” of these functions on a furnish-and-install contract, it has not performed a CUF and the cost of materials cannot be counted toward DBE COA Goal. Leasing of equipment from a leasing company is allowed. However, leasing/purchasing equipment from the Contractor is not allowed. Lease agreements shall be provided prior to the Subcontractor beginning Work. Any use of the Contractor’s equipment by a DBE may not be credited as countable participation. The DBE does not perform a CUF if its role is limited to that of an extra participant in a transaction, contract, or project through which the funds are passed in order to obtain the appearance of DBE participation. In order for a DBE traffic control company to be considered to be performing a CUF, the DBE must be in control of its work inclusive of supervision. The DBE shall employ a Traffic Control Supervisor who is directly involved in the management and supervision of the traffic control employees and services. The following are some of the factors that the Engineer will use in determining whether a DBE trucking company is performing a CUF: • The DBE shall be responsible for the management and supervision of the entire trucking operation for which it is responsible on the contract. The owner demonstrates business related knowledge, shows up on site and is determined to be actively running the business. • The DBE itself shall own and operate at least one fully licensed, insured, and operational truck used on the Contract. The drivers of the trucks owned and leased by the DBE must be exclusively employed by the DBE and reflected on the DBE’s payroll. • Lease agreements for trucks shall indicate that the DBE has exclusive use of and control over the truck(s). This does not preclude the leased truck from working for others provided it is with the consent of the DBE and the lease provides the DBE absolute priority for use of the leased truck. • Leased trucks shall display the name and identification number of the DBE. UDBE/DBE/FSBE Truck Unit Listing Log In addition to the subcontracting requirements of Section 1-08.1, each DBE trucking firm shall submit supplemental information consisting of a completed Primary UDBE/DBE/FSBE Truck Unit Listing Log (WSDOT Form 350-077), copy of vehicle registrations, and all Rental/Lease agreements (if applicable). The supplemental information shall be submitted to the Engineer prior to any trucking services being performed for DBE credit. Incomplete or incorrect supplemental information will be returned for correction. The corrected Primary UDBE/DBE/FSBE Truck Unit Listing Log and any Updated Primary UDBE/DBE/FSBE Truck Unit Listing Logs shall be 212th St. Preservation/Holcomb SP - 35 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 submitted and accepted by the Engineer no later than ten calendar days of utilizing applicable trucks. Failure to submit or update the DBE Truck Unit Listing Log may result in trucks not being credited as DBE participation. Each DBE trucking firm shall complete a Daily UDBE/DBE/FSBE Trucking Unit Listing Log for each day that the DBE performs trucking services for DBE credit. The Daily UDBE/DBE/FSBE Trucking Unit Listing Log forms shall be submitted to the Engineer by Friday of the week after the work was performed. Joint Checking A joint check is a check between a Subcontractor and the Contractor to the supplier of materials/supplies. The check is issued by the Contractor as payer to the Subcontractor and the material supplier jointly for items to be incorporated into the project. The DBE must release the check to the supplier, while the Contractor acts solely as the guarantor. A joint check agreement must be approved by the Engineer and requested by the DBE involved using the DBE Joint Check Request Form (form # 272-053) prior to its use. The form must accompany the DBE Joint Check Agreement between the parties involved, including the conditions of the arrangement and expected use of the joint checks. The approval to use joint checks and the use will be closely monitored by the Engineer. To receive DBE credit for performing a CUF with respect to obtaining materials and supplies, a DBE must “be responsible for negotiating price, determining quality and quantity, ordering the material, installing and paying for the material itself.” The Contractor shall submit DBE Joint Check Request Form tothe Engineer and be in receipt of written approval prior to using a joint check. Material costs paid by the Contractor directly to the material supplier are not allowed. If proper procedures are not followed or the Engineer determines that the arrangement results in lack of independence for the DBE involved, no DBE credit will be given for the DBE’s participation as it relates to the material cost. Prompt Payment Prompt payment to all subcontractors shall be in accordance with Section 1-08.1. Prompt payment requirements apply to progress payments as well as return of retainage. Subcontracts Prior to a DBE performing Work on the Contract, an executed subcontract between the DBE and the Contractor shall be submitted to the Engineer. The executed subcontracts shall be submitted by email to the following email address NWRegionOEO@wsdot.wa.gov 212th St. Preservation/Holcomb SP - 36 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The prime contractor shall notify the Engineer in writing within five calendar days of subcontract submittal. Reporting The Contractor and all subcontractors/suppliers/service providers that utilize DBEs to perform work on the project, shall maintain appropriate records that will enable the Engineer to verify DBE participation throughout the life of the project. Refer to Section 1-08.1 for additional reporting requirements associated with this contract. Changes in COA Work Committed to DBE The Contractor shall utilize the COA DBEs to perform the work and supply the materials for which each is committed unless prior written approval by the Engineer is received by the Contractor. The Contractor shall not be entitled to any payment for work or material completed by the Contractor or subcontractors that was committed to be completed by the COA DBEs in the DBE Utilization Certification form. Owner Initiated Changes In instances where the Engineer makes changes that result in changes to Work that was committed to a COA DBE the Contractor may be directed to substitute for the Work. Contractor Initiated Changes The Contractor cannot change the scope or reduce the amount of work committed to a COA DBE without good cause. Reducing DBE Commitment is viewed as partial DBE termination, and therefore subject to the termination procedures below. Original Quantity Underruns In the event that Work committed to a DBE firm as part of the COA underruns the original planned quantities the Contractor may be required to substitute other remaining Work to another DBE. Contractor Proposed DBE Substitutions Requests to substitute a COA DBE must be for good cause (see DBE termination process below), and requires prior written approval of the Engineer. After receiving a termination with good cause approval, the Contractor may only replace a DBE with another certified DBE. When any changes between Contract Award and Execution result in a substitution of COA DBE, the substitute DBE shall have been certified prior to the bid opening on the Contract. DBE Termination Termination of a COA DBE (or an approved substitute DBE) is only allowed in whole or in part for good cause and with prior written approval of the Engineer. If the Contractor terminates a COA DBE without the prior written approval of the Engineer, the Contractor shall not be entitled to payment for work or material committed to, but not performed/supplied by the COA 212th St. Preservation/Holcomb SP - 37 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DBE. In addition, sanctions may apply as described elsewhere in this specification. Prior to requesting approval to terminate a COA DBE, the Contractor shall give notice in writing to the DBE with a copy to the Engineer of its intent to request to terminate DBE Wo rk and the reasons for doing so. The DBE shall have five (5) days to respond to the Contractor’s notice. The DBE’s response shall either support the termination or advise the Engineer and the Contractor of the reasons it objects to the termination of its subcontract. If the request for termination is approved, the Contractor is required to substitute with another DBE to perform at least the same amount of work as the DBE that was terminated (or provide documentation of GFE). A plan to replace the COA DBE Commitment amount shall be submitted to the Engineer within 2 days of the approval of termination. The plan to replace the Commitment shall provide the same detail as that required in the DBE Utilization Certification. The Contractor must have good cause to terminate a COA DBE. Good cause typically includes situations where the DBE Subcontractor is unable or unwilling to perform the work of its subcontract. Good cause may exist if: • The DBE fails or refuses to execute a written contract. • The DBE fails or refuses to perform the Work of its subcontract in a way consistent with normal industry standards. • The DBE fails or refuses to meet the Contractor’s reasonable nondiscriminatory bond requirements. • The DBE becomes bankrupt, insolvent, or exhibits credit unworthiness. • The DBE is ineligible to work on public works projects because of suspension and debarment proceedings pursuant to federal law or applicable State law. • The DBE is ineligible to receive DBE credit for the type of work involved. • The DBE voluntarily withdraws from the project and provides written notice of its withdrawal. • The DBE’s work is deemed unsatisfactory by the Engineer and not in compliance with the Contract. • The DBE’s owner dies or becomes disabled with the result that the DBE is unable to complete its Work on the Contract. 212th St. Preservation/Holcomb SP - 38 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Good cause does not exist if: • The Contractor seeks to terminate a COA DBE so that the Contractor can self-perform the Work. • The Contractor seeks to terminate a COA DBE so the Contractor can substitute another DBE contractor or non-DBE contractor after Contract Award. • The failure or refusal of the COA DBE to perform its Work on the subcontract results from the bad faith or discriminatory action of the Contractor (e.g., the failure of the Contractor to make timely payments or the unnecessary placing of obstacles in the path of the DBE’s Work). Decertification When a DBE is “decertified” from the DBE program during the course of the Contract, the participation of that DBE shall continue to count as DBE participation as long as the subcontract with the DBE was executed prior to the decertification notice. The Contractor is obligated to substitute when a DBE does not have an executed subcontract agreement at the time of decertification. Consequences of Non-Compliance Breach of Contract Each contract with a Contractor (and each subcontract the Contractor signs with a Subcontractor) must include the following assurance clause: The Contractor, subrecipient, or Subcontractor shall not discriminate on the basis of race, color, national origin, or sex in the performance of this contract. The Contractor shall carry out applicable requirements of 49 CFR Part 26 in the award and administration of DOT-assisted contracts. Failure by the Contractor to carry out these requirements is a material breach of this Contract, which may result in the termination of this Contract or such other remedy as the recipient deems appropriate, which may include, but is not limited to: (1) Withholding monthly progress payments; (2) Assessing sanctions; (3) Liquidated damages; and/or (4) Disqualifying the Contractor from future bidding as non- responsible. Notice If the Contractor or any Subcontractor, Consultant, Regular Dealer, or service provider is deemed to be in non-compliance, the Contractor will be informed in writing, by certified mail by the Engineer that sanctions will be imposed for failure to meet the DBE COA Commitment and/or submit documentation of good faith efforts. The notice will state the specific 212th St. Preservation/Holcomb SP - 39 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 sanctions to be imposed which may include impacting a Contractor or other entity’s ability to participate in future contracts. Sanctions If it is determined that the Contractor’s failure to meet all or part of the DBE COA Commitment is due to the Contractor’s inadequate good faith efforts throughout the life of the Contract, including failure to submit timely, required Good Faith Efforts information and documentation, the Contractor may be required to pay DBE penalty equal to the amount of the unmet Commitment, in addition to the sanctions outlined in Section 1-07.11(5). Payment Compensation for all costs involved with complying with the conditions of this Specification and any other associated DBE requirements is included in payment for the associated Contract items of Work, except otherwise provided in the Specifications. 1-07.12 Federal Agency Inspection Section 1-07.12 is supplemented with the following: (January 25, 2016 WSDOT GSP) Required Federal Aid Provisions The Required Contract Provisions Federal Aid Construction Contracts (FHWA 1273) Revised May 1, 2012 and the amendments thereto supersede any conflicting provisions of the Standard Specifications and are made a part of this Contract; provided, however, that if any of the provisions of FHWA 1273, as amended, are less restrictive than Washington State Law, then the Washington State Law shall prevail. The provisions of FHWA 1273, as amended, included in this Contract require that the Contractor insert the FHWA 1273 and amendments thereto in each Subcontract, together with the wage rates which are part of the FHWA 1273, as amended. Also, a clause shall be included in each Subcontract requiring the Subcontractors to insert the FHWA 1273 and amendments thereto in any lower tier Subcontracts, together with the wage rates. The Contractor shall also ensure that this section, REQUIRED FEDERAL AID PROVISIONS, is inserted in each Subcontract for Subcontractors and lower tier Subcontractors. For this purpose, upon request to the Project Engineer, the Contractor will be provided with extra copies of the FHWA 1273, the amendments thereto, the applicable wage rates, and this Special Provision. SECTION 1-07.17 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTIONS: (******) 1-07.17(4) Payment (Kent Special Provision) New Section All costs to comply with subsection 1-07.17(3) and for the protection and repair of all identified or suspected underground utilities specified in RCW 19.122 are 212th St. Preservation/Holcomb SP - 40 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 incidental to the contract and are the responsibility of the Contractor/excavator. The Contractor shall include all related costs in the unit bid prices of the contract. (******) 1-07.17(5) Notification of Excavation (Kent Special Provision) New Section Within ten business days but not less than two business days prior to the commencement of excavation, the Contractor shall provide written notice (or other form of notice acceptable to the Engineer) to all owners of underground facilities, whether public or private, that excavation will occur, and when excavation will occur. (******) 1-07.17(6) Site Inspection (Kent Special Provision) New Section The following list of contacts is provided only as a convenience to the Contractor. Lumen (CenturyLink) Jesse Patjens 425-429-5722 Jesse.Patjens@lumen.com Comcast Danny Cooley (253) 686-7592 (cell) Danny_Cooley@comcast.com Puget Sound Energy Gas Glenn Helton 253-395-6926 425-559-4647 (cell) Puget Sound Energy Power Hong Nguyen 425-449-6609 (cell) Hong.Nguyen@pse.com Verizon Scott Christenson 425-636-6046 425-471-1079 (cell) King County Wastewater (Metro Sewer) Mark Lampard 206-477-5414 King County Metro Transit David Korthals 206-477-5776 SECTION 1-07.18 IS DELETED AND REPLACED WITH THE FOLLOWIGN: (******) 1-07.18 Public Liability and Property Damage Insurance (Kent Special Provision) Insurance The Licensee’s (City of Kent is the Licensee) Contractor (hereinafter, Contractor) shall procure and maintain for the duration of the Agreement, insurance against claims for 212th St. Preservation/Holcomb SP - 41 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 injuries to persons or damage to property which may arise from or in connection with the performance of the work hereunder by the Contractor, their agents, representatives, employees or subcontractors. A. Minimum Scope of Insurance Contractor shall obtain insurance of the types described below: 1. Commercial General Liability insurance. Commercial general liability (CGL) with a limit of not less than $5,000,000 each occurrence and an aggregate limit of not less than $10,000,000. CGL insurance must be written on ISO occurrence form CG 00 01 12 04 (or a substitute form providing equivalent coverage). The policy must also contain the following endorsement, which must be stated on the certificate of insurance: • Contractual Liability Railroads ISO form CG 24 17 10 01 (or a substitute form providing equivalent coverage) showing the “City of Kent”, “Union Pacific Railroad Company Property” and ”BNSF Railway Company Property” as the Designated Job Sites. 2. Business Automobile Coverage insurance. Business auto coverage written on ISO form CA 00 01 (or a substitute form providing equivalent liability coverage) with a combined single limit of not less $2,000,000 for each accident. The policy must contain the following endorsements, which must be stated on the certificate of insurance: • Coverage For Certain Operations In Connection With Railroads ISO form CA 20 70 10 01 (or a substitute form providing equivalent coverage) showing the “City of Kent”, “Union Pacific Railroad Company Property” and ”BNSF Railway Company Property” as the Designated Job Sites. • Motor Carrier Act Endorsement - Hazardous materials clean up (MCS-90) if required by law. 3. Workers Compensation and Employers Liability insurance. Coverage must include but not be limited to: • Statutory liability under the workers' compensation laws of the state(s) affected by this Agreement. • Employers' Liability (Part B) with limits of at least $500,000 each accident, $500,000 disease policy limit $500,000 each employee. • If the Contractor is self-insured, evidence of state approval and excess workers compensation coverage must be provided. Coverage must include liability arising out of the U. S. Longshoremen's and Harbor Workers' Act, the Jones Act, and the Outer Continental Shelf Land Act, if applicable. 212th St. Preservation/Holcomb SP - 42 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 4. Railroad Protective Liability insurance. The Contractor shall purchase and maintain separate Railroad Protective Liability insurance written on ISO occurrence form CG 00 35 12 04 (or a substitute form providing equivalent coverage) on behalf of each Railroad (UPRR and BNSF) as named insured, with a limit of not less than $2,000,000 per occurrence and an aggregate of $6,000,000. A binder stating the policies are in place must be submitted to the City of Kent and the respective Railroad, both Union Pacific Railroad and BNSF Railway before the work may be commenced and until the original policy is forwarded to each Railroad. 5. Umbrella or Excess insurance. If the Contractor utilizes umbrella or excess policies, these policies must “follow form” and afford no less coverage than the primary policy. 6. Pollution Liability insurance. Pollution Liability coverage must be included when the scope of the work as defined in the Agreement includes installation, temporary storage, or disposal of any “hazardous” material that is injurious in or upon land, the atmosphere, or any watercourses; or may cause bodily injury at any time. Pollution liability coverage must be written on ISO form Pollution Liability Coverage Form Designated Sites CG 00 39 12 04 (or a substitute form providing equivalent liability coverage), with limits of at least $5,000,000 per occurrence and an aggregate limit of $10,000,000. If the scope of work as defined in this contract includes the disposal of any hazardous or non-hazardous materials from the job site, the Contractor shall furnish to the City of Kent and the Railroad evidence of pollution legal liability insurance maintained by the disposal site operator for losses arising from the insured facility accepting the materials, with coverage in minimum amounts of $1,000,000 per loss, and an annual aggregate of $2,000,000. B. Other Requirements 7. All policy(ies) required above (except business automobile, worker’s compensation and employers liability) must include the City of Kent, Union Pacific Railroad and BNSF Railway as “Additional Insured” using ISO Additional Insured Endorsement CG 20 26, (or substitute form(s) providing equivalent coverage). The coverage provided to Railroad as additional insured shall not be limited by the Contractor's liability under the indemnity provisions of this Agreement. THE CITY OF KENT, UNION PACIFIC RAILROAD AND BNSF RAILWAY EXPECT THAT THEY WILL BE PROVIDED WITH THE BROADEST POSSIBLE COVERAGE AVAILABLE BY OPERATION OF LAW UNDER ISO ADDITIONAL INSURED FORM CG 20 26. 8. Punitive damages exclusion, if any, must be deleted (and the deletion indicated on the certificate of insurance), unless (a) insurance coverage may not lawfully be obtained for any punitive damages that may arise under this agreement, or 212th St. Preservation/Holcomb SP - 43 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (b) all punitive damages are prohibited by all states in which this agreement will be performed. 9. The Contractor waives all rights against the City of Kent, Union Pacific Railroad, BNSF Railway and its agents, officers, directors and employees for recovery of damages to the extent these damages are covered by the workers compensation and employers liability or commercial umbrella or excess liability insurance obtained by required by this agreement. 10. Prior to commencing the work, the Contractor shall furnish the City of Kent, Union Pacific Railroad and BNSF Railway with certificate(s) of insurance, executed by a duly authorized representative of each insurer, showing compliance with the insurance requirements in this Agreement. 11. All insurance policies must be written by a reputable insurance company acceptable to the City of Kent, Union Pacific Railroad and BNSF Railway or with a current Best's Insurance Guide Rating of A- and Class VII or better, and authorized to do business in the state(s) in which the work is to be performed. ROE 880702 Form Approved, AVP-Law 12. The fact that insurance is obtained by the Contractor will not be deemed to release or diminish the liability of the Contractor including, without limitation, liability under the indemnity provisions of this Agreement. Damages recoverable by the City of Kent, Union Pacific Railroad and BNSF Railway from the Contractor or any third party will not be limited by the amount of the required insurance coverage. 13. The Contractor shall include all subcontractors as insureds under its policies or shall furnish separate certificates and endorsements for each subcontractor. All coverages for subcontractors shall be subject to all of the same insurance requirements as stated herein for the Contractor. 14. All insurance policies and coverages required under Sections 1-07.18 and 1- 07.10 shall contain a waiver of subrogation against the Contracting Agency, the State, and any Additional Insureds, and their respective departments, agencies, boards, and commissions, and their respective officers, officials, agents, and employees for losses arising from Work performed by or on behalf of the Contractor. This waiver has been mutually negotiated by the parties. 15. Unless specifically noted otherwise in the Contract Documents, the parties to this Contract do not intend by any of the provisions of this Contract to cause the public or any member thereof or any other Person to be a third-party beneficiary of the Contract Documents. Nothing in this Contract authorizes anyone not a party to this Contract or a designated third-party beneficiary to this Contract to maintain a suit for personal injuries or property damage pursuant to the terms or provisions of this Contract. It is the further intent of the Contracting Agency and the Contractor in executing the Form of Contract that no individual, firm, corporation, or any combination thereof that supplies materials, labor, services, 212th St. Preservation/Holcomb SP - 44 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 or equipment to the Contractor for the performance of the Work shall become thereby a third-party beneficiary of this Contract. The Contract Documents shall not be construed to create a contractual relationship of any kind between the Contracting Agency and a Subcontractor or any other Person except the Contractor. 16. With the exception of the Commercial Automobile liability coverage, no policies of insurance required under this section shall contain an arbitration or alternative dispute resolution clause applicable to disputes between the insurer and its insureds. Any and all disputes concerning (i) terms and scope of insurance coverage afforded by the policies required hereunder and/or (ii) extra contractual remedies and relief, which may be afforded policy holders in connection with coverage disputes, shall be resolved in Washington Superior Court, applying Washington law. The contractor will be allowed one (1) ten (10) working day work window per railroad crossing to complete all work within thirty (30) feet of any track. Work windows can occur concurrently provided the total impacts for any individual track crossing is limited to a maximum of (10) ten days of impact. Railroad crossing work includes but is not limited to sidewalk, signals, curbing, planning, and paving. Contractor shall submit a work plan, schedule, and traffic control plan for the engineers review a minimum of 21 days prior to beginning work within the railroad right-of-way. No work shall commence until the engineer provides approval of the work plan. (September 8, 2020 WSDOT GSP) Relations With Railroad The term Railroad Company, as used in these specifications shall be applicable to each of the following railroad companies: Union Pacific Railroad Burlington Northern Santa Fe Railway Protection of Railroad Property The Contractor shall exercise care in all operations and shall, at the Contractor's expense, protect the property of the Railroad Company and the Company’s appurtenances, property in its custody, or persons lawfully upon its right of way, from damage, destruction, interference or injury caused by the Contractor’s operations. The Contractor shall prosecute the work to not interfere with the Railroad Company or its appurtenances, or any of the Railroad Company's trains or facilities, and shall complete the work to a condition that shall not interfere with or menace the integrity or safe and successful operations of the Railroad Company or its appurtenances, or any of the Railroad Company's trains or facilities. The Contractor shall not transport equipment, machinery, or materials across the Railroad Company's tracks, except at a public crossing, without the written consent of the Railroad Company. 212th St. Preservation/Holcomb SP - 45 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Contractor shall keep the right of way and ditches of the Railroad Company open and clean from any deposits or debris resulting from its operations. The Contractor shall be responsible for the cost to clean and restore ballast of the Railroad Company which is disturbed or becomes fouled with dirt or materials when such deposits or damage result from the Contractor’s operations, except as provided elsewhere. The Contractor's work shall be conducted in such a manner that there will be a minimum of interference with the operation of the railroad. For Class 1 Railroads (BNSF and UPRR) the Railroad Company will specify what periods will be available to the Contractor for executing any part of the work in which the Railroad Company's tracks will be obstructed or made unsafe for operation of the railroad. No interference with Class 1 Railroad Company operations will be permitted between October 1 and December 31. The Railroad Company may change these requirements to be more or less restrictive. Requests for extensions of time due to additional Railroad restrictions shall be in accordance with Section 1-08.8. Additional Railroad restrictions will not be eligible for a cost adjustment. In the event that an emergency occurs in connection with the work specified, the Railroad Company reserves the right to do any and all work that may be necessary to maintain railroad traffic. If the emergency is caused by the Contractor, the Contractor shall be responsible for all Railroad Company costs associated with the emergency response. Protective services to protect the Railroad Company's facilities, property, and movement of its trains or engines, including railroad flagging and other devices, may be required by the Railroad Company as a result of the Contractor's operations. The nature and extent of protective services, personnel and other measures required will in all cases be determined by the Railroad Company. Nothing in these specifications will limit the Railroad Company's right to determine and assign the number of personnel, the classes of personnel for protective services, nor other protective measures it deems necessary. When, in the opinion of the Railroad Company, the services of flaggers or inspectors are necessary for the protection of the Railroad Company's facilities by reason of the Contractor's operations, the Railroad Company will furnish such flaggers or inspectors as may be required. The Contractor shall notify the Railroad Company a minimum of ten (10) working days in advance of Contractor commencing its work and at least thirty (30) working days in advance of whenever the Contractor is about to perform work within Railroad Company property or within 25 feet of the tracks to enable the Railroad Company to provide flagging or other protective services. The Railroad Company’s contact to schedule flagging or other protective services is: 212th St. Preservation/Holcomb SP - 46 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 UPRR UPRR Western Region Manager Public Projects - Engineering: Peggy Ygbuhay 916-789-5033 and UPRR Railroad Representative - MGR I SIGNAL MNTCE James Johnson 1055 Jackson St SE ALBANY, OR 97322 503-249-2237 UPRR Flagging Services: The City has contracted with RailPros Field Services and will pay them directly. Heather Morris heather.morris@railpros.com 877.315.0513 x116 212th UPRR Location Information: RR Milepost 169.02 DOT #396-575R Lat. 47.41194, Long -122.2416 Seattle Subdivision Folder No. 3154-81 BNSF BNSF Roadmaster Gregory Murphy Gregory.Murphy@BNSF.com 360.815.4643 212th BNSF Location Information: Line Segment 0051 and Mile Post 14.19 DOT #085625H Lat. 47.411983, Long -122.23624 Seattle Subdivision Permit number: 19-63101 No act of the Railroad Company in supervising or approving any work shall reduce or in any way affect the liability of the Contractor for damages, expense, or cost which may result to the Railroad Company from the construction of this Contract. Unless otherwise provided, all personnel assigned by the Railroad Company, other than those engaged in performing work by the Railroad Company as listed under Construction Work by Railroad Company, will be considered protective personnel. 212th St. Preservation/Holcomb SP - 47 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 In general, the Railroad Company will furnish protective services whenever any of the Contractor's operations take place within or near railroad right of way and, in the opinion of the Railroad Company's representative, could endanger railroad facilities or create a hazard to railroad operations. The Railroad Company’s policy for assignment of railroad flaggers requires that the flagging position is established for fixed work days and times. Any railroad flagging performed outside of these parameters may be subject to overtime costs. The Contractor shall verify with the Railroad Company what categories of railroad flagging constitute overtime work, and obtain prior authorization from the Engineer before coordinating with the Railroad Company for flagging requiring overtime payments. The Contractor shall submit to the Railroad Company and the Engineer, in writing, an itinerary of work within the Railroad Company’s right of way or otherwise requiring a Railroad Company flagger for the following week. If such work spans multiple weeks, the itinerary shall be provided in advance of each work week. There will be no cost to the Contractor for the railroad protective services, unless: • Such services result from the Contractor’s failure to comply with the terms and conditions of its contract with the Contracting Agency or with its Contractor’s Right of Entry Agreements with the Railroad Company. • The Contractor fails to obtain authorization from the Engineer prior to coordinating with the Railroad Company for any flagging requiring overtime payments. • The Contractor arranges for assignment of a railroad flagger and alters Project work so that a flagger is no longer needed, and adequate advance notice is not provided to the Railroad Company of such change in the need for a flagger (i.e. causing the Railroad Company to dispatch a flagger billable to the Project when one is not required). • The Contractor causes an emergency, as discussed above. Construction Work by Railroad Company The work by the Railroad Company as described below will be performed by the Railroad Company with its own forces at no cost to the Contractor: N/A All work which is performed by the Railroad Company at the Contractor's request and which is for the Contractor's benefit or convenience shall be at the Contractor's expense and the Contractor shall reimburse the Railroad Company for all costs for such work. 212th St. Preservation/Holcomb SP - 48 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Contractor shall cooperate with the Railroad Company and so conduct operations that the necessary reconstruction of its facilities and the removal of existing facilities can be accomplished without interruption of service. Contractor’s Right of Entry Agreement For all matters regarding the Contractor’s Right of Entry Agreement, the Contractor shall contact: UPRR Daniel Peters Public Projects – Real Estate 1400 Douglas Street STOP 1690 Omaha, NE 68179-1690 402-544-8549 Dcpeters02@up.com BNSF Katie Robles Manager – Permits JLL - Rail Practice Group 4200 Buckingham Rd. Suite 110 Fort Worth, TX 76155 Direct 817-230-2631 katie.robles@am.jll.com No work shall be commenced within the Railroad Company’s Property until the Contractor has executed, delivered, and received in return the fully executed Contractor’s Right-of-Entry Agreement from the Railroad Company, and has obtained all of the insurance required by the Railroad Company as specified therein. All work within the Railroad Company’s right of way or within 25 feet of a public railroad grade crossing shall be in accordance with Railroad’s Contractor Requirements and the Contractor’s Right of Entry Agreement. The Contracting Agency has furnished a draft Contractor’s Right of Entry Agreement in Appendix 13. The draft Contractor’s Right of Entry Agreement represents the Contracting Agency’s assessment of the likely terms and conditions prior to Advertisement for Bids. The final terms and conditions will be determined by the Railroad Company after Contract Execution. The Contractor, it subcontractors or agents, shall at its own expense, obtain and maintain in force all insurance required by Railroad until the completion date of the contract as described in Section 1-08.5 except as stated herein. When all the work involving construction activities within or immediately adjacent to the railroad right of way is completed, the Contractor may make a written request to the Engineer to be relieved of the responsibility to continue all or part of the insurance specified above. If the Engineer deems the portion of the work in that area is complete, the Engineer may approve the Contractor's request. However, if for any reason the Contractor resumes or starts any new work in that area (including being ordered to do so by the Engineer), the insurance shall be reinstated by the Contractor before the work is started. If the insurance must be reinstated because of the 212th St. Preservation/Holcomb SP - 49 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Contractor's operations or failure of the Contractor to perform all the contract requirements, the costs shall be the responsibility of the Contractor. If the insurance must be reinstated because of changes to the contract, the costs will be considered in accordance with Section 1-04.4. Submittals and Working Drawings Unless specified elsewhere in the Contract, all submittals and Working Drawings prepared by the Contractor for review by the Railroad Company shall be Type 3 or 3E Working Drawings. The Contractor shall submit Working Drawings to the Project Engineer. The Contracting Agency will coordinate Working Drawing review with the Railroad Company. The Contractor shall develop a progress schedule that includes Working Drawing reviews by the Railroad Company. (August 7, 2006 WSDOT GSP) Contractor’s Right of Entry and Insurance Requirements – BNSF No work shall commence within BNSF Railway Company (BNSF) right of way until the Contractor has executed, delivered, and received in return the fully executed Contractor’s Right-of-Entry Agreement from BNSF, and has obtained all of the insurance required by the Railroad. All work within BNSF’s right of way shall be in accordance with BNSF’s Contractor Requirements and the Contractor’s Right of Entry Agreement (See Appendices). The Contractor, its Subcontractors or agents, shall at its own expense, obtain and maintain in force all insurance required by BNSF until the completion date of the contract as described in Section 1-08.5 except as stated herein. When all the work involving construction activities within or immediately adjacent to the Railroad right of way is completed, the Contractor may make a written request to the Engineer to be relieved of the responsibility to continue the insurance required by BNSF. If the Engineer deems the portion of the work in that area is complete, the Engineer may approve the Contractor's request. However, if for any reason the Contractor resumes or starts any new work in that area (including being ordered to do so by the Engineer), the insurance shall be reinstated by the Contractor before the work is started. If the insurance must be reinstated because of the Contractor’s activities or failure of the Contractor to perform all the contract requirements, the costs shall be the responsibility of the Contractor. If the insurance must be reinstated because of changes to the contract, the costs will be considered in accordance with Section 1-04.4. (August 7, 2006 WSDOT GSP) Contractor’s Right of Entry and Insurance Requirements - UPRR No work shall commence within Union Pacific Railroad right of way until the Contractor has executed, delivered, and received in return the fully executed Contractor’s Right-of-Entry Agreement from Union Pacific Railroad, and has obtained all of the insurance required by the Railroad. All work within Union 212th St. Preservation/Holcomb SP - 50 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Pacific Railroad’s right of way shall be in accordance with the Contractor’s Right of Entry Agreement (See Appendixes). The Contractor, its Subcontractors or agents, shall at its own expense, obtain and maintain in force all insurance required by Union Pacific Railroad until the completion date of the contract as described in Section 1-08.5 except as stated herein. When all the work involving construction activities within or immediately adjacent to the railroad right of way is completed, the Contractor may make a written request to the Engineer to be relieved of the responsibility to continue the insurance required by Union Pacific Railroad. If the Engineer deems the portion of the work in that area is complete, the Engineer may approve the Contractor's request. However, if for any reason the Contractor resumes or starts any new work in that area (including being ordered to do so by the Engineer), the insurance shall be reinstated by the Contractor before the work is started. If the insurance must be reinstated because of the Contractors activities or failure of the Contractor to perform all the contract requirements, the costs shall be the responsibility of the Contractor. If the insurance must be reinstated because of changes to the contract, the costs will be considered in accordance with Section 1-04.4. 1-07.23 Public Convenience and Safety 1-07.23(1) Construction Under Traffic Section 1-07.23(1) is supplemented with the following: (February 3, 2020, WSDOT GSP) Work Zone Clear Zone The Work Zone Clear Zone (WZCZ) applies during working and nonworking hours. The WZCZ applies only to temporary roadside objects introduced by the Contractor’s operations and does not apply to preexisting conditions or permanent Work. Those work operations that are actively in progress shall be in accordance with adopted and approved Traffic Control Plans, and other contract requirements. During nonworking hours equipment or materials shall not be within the WZCZ unless they are protected by permanent guardrail or temporary concrete barrier. The use of temporary concrete barrier shall be permitted only if the Engineer approves the installation and location. During actual hours of work, unless protected as described above, only materials absolutely necessary to construction shall be within the WZCZ and only construction vehicles absolutely necessary to construction shall be allowed within the WZCZ or allowed to stop or park on the shoulder of the roadway. The Contractor's nonessential vehicles and employees private vehicles shall not be permitted to park within the WZCZ at any time unless protected as described above. 212th St. Preservation/Holcomb SP - 51 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Deviation from the above requirements shall not occur unless the Contractor has requested the deviation in writing and the Engineer has provided written approval. Minimum WZCZ distances are measured from the edge of traveled way and will be determined as follows: Minimum Work Zone Clear Zone Distance SECTION 1-07.23(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 1.07.23(1) Construction Under Traffic (Kent Special Provision) The Contractor shall not have the sidewalks on both sides of the street under construction at the same time. Sidewalk and curb ramp construction shall be staged to provide pedestrian access on one side of the street at all times. The Interurban Trail and associated crosswalk of S 212th St shall not be closed. During non-working hours pedestrian crossing at the crosswalks at 76th Ave and 77th Ave shall be open to pedestrian traffic. Lane Restrictions Lane closures for the S 212th Street overlay are prohibited at all times except as provided in these specifications. All work excluding planing and paving hours: Lane closures for S 212th Street are allowed as follows: Single Lane Closure (minimum two travel lanes shall remain open in each direction): Day of Week Time Monday 9:00 a.m. to 3:00 p.m. Tuesday 9:00 a.m. to 3:00 p.m. Wednesday 9:00 a.m. to 3:00 p.m. Thursday 9:00 a.m. to 3:00 p.m. Friday 9:00 a.m. to 3:00 p.m. Double Lane Closure (minimum one travel lane shall remain open in each direction): Regulatory Posted Speed Distance From Traveled Way (Feet) 35 mph or less 10 40 mph 15 45 to 50 mph 20 60 mph or greater 35 212th St. Preservation/Holcomb SP - 52 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Day of Week Time Sunday 8:00 p.m. to 6:00 a.m. Monday 8:00 p.m. to 6:00 a.m. Tuesday 8:00 p.m. to 6:00 a.m. Wednesday 8:00 p.m. to 6:00 a.m. Thursday 8:00 p.m. to 6:00 a.m. Planing and Paving Lane closures for the S 212th Street overlay are allowed for planing and paving work as follows: Single or Double Lane Closure (minimum one lane open in each direction): Sunday 8:00 p.m. to Monday 6:00 a.m. Monday 8:00 p.m. to Tuesday 6:00 a.m. Tuesday 8:00 p.m. to Wednesday 6:00 a.m. Wednesday 8:00 p.m. to Thursday 6:00 a.m. Thursday 8:00 p.m. to Friday 6:00 a.m. All striping for lane shifts, per direction of travel, shall be completed within the same work shift, unless otherwise approved in writing by the Engineer. There shall be no delay to medical, fire, police, or other emergency vehicles with flashing lights or sirens. The contractor shall alert all flaggers and personnel of this requirement. The Contractor shall notify the Engineer, in writing, a minimum of 3 working days prior to any lane closures. If the Engineer determines the permitted closure hours adversely affect traffic, the Engineer may adjust the hours accordingly. The Engineer will notify the Contractor in writing of any change in the closure hours. Lane closures or roadway closures are not allowed on any of the following, which shall take precedence over the allowable hours of lane closures above: 1. A holiday, 2. A holiday weekend; holidays that occur on Friday, Saturday, Sunday or Monday are considered a holiday weekend. A holiday weekend includes Saturday, Sunday, and the holiday. 3. After 12:00 p.m. (noon) on the day prior to a holiday or holiday weekend. 4. From midnight through noon the day following a holiday or holiday weekend. Construction Vehicles Construction vehicles using a closed traffic lane shall travel only in the normal direction of traffic flow unless expressly allowed in an approved traffic control plan. Construction vehicles shall be equipped with flashing or rotating amber lights, and in operation when in the work zone. Controlled Access 212th St. Preservation/Holcomb SP - 53 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 No special access or egress will be allowed the Contractor other than normal legal movements or as shown in the Plans. Public Notification The Contractor shall furnish and install information signs that provide advance notification of lane(s) closure, a minimum of seven (7) calendar days prior to the closure. PCMS may be used for this notice. Sign locations, and messages, shall be as provided to the Engineer for approval. Railroad Notification RailPros Field Services (UPRR approved flagging services) and BNSF Railway flagger and protective services and devices will be required and furnished whenever the Contractor’s work activities are located over or under of and within twenty-five (25) feet measured horizontally from centerline of the respective UPRR and BNSF tracks. The City has contracted with RailPros Field Services and will pay them directly. The contractor shall notify the RailPros at least ten (10) working days in advance of Contractor commencing its work and at least thirty (30) working days in advance of proposed performance of any work by Contractor within twenty-five feet of the tracks. The Contractor shall give a minimum of at least thirty (30) working days notice to the roadmaster at Marshall.Flores@BNSF.com, telephone (253) 591-2563 and Gregory Murphy (contact information in KSP 1-07.18), in advance of when flagging services will be required to bulletin the flaggers position and shall provide five (5) working days notice to the Road master to abolish the position per union requirements. SECTION 1-07.24 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 1-07.24 Rights of Way (Kent Special Provision) Street right of way lines, limits of easements and limits of construction are indicated or defined on the plans. The Contractor's construction activities shall be confined within these limits, unless arrangements for use of private property are made. 1-08 PROSECUTION AND PROGRESS Add the following new section: 1-08.0 Preliminary Matters (May 25, 2006 APWA GSP) 212th St. Preservation/Holcomb SP - 54 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Add the following new section: 1-08.0(1) Preconstruction Conference (October 10, 2008 APWA GSP) Prior to the Contractor beginning the work, a preconstruction conference will be held between the Contractor, the Engineer and such other interested parties as may be invited. The purpose of the preconstruction conference will be: 1. To review the initial progress schedule; 2. To establish a working understanding among the various parties associated or affected by the work; 3. To establish and review procedures for progress payment, notifications, approvals, submittals, etc.; 4. To establish normal working hours for the work; 5. To review safety standards and traffic control; and 6. To discuss such other related items as may be pertinent to the work. The Contractor shall prepare and submit at the preconstruction conference the following: 1. A breakdown of all lump sum items; 2. A preliminary schedule of working drawing submittals; and 3. A list of material sources for approval if applicable 1-08.1 Subcontracting (December 19, 2019 APWA GSP, Option A) Prior to any subcontractor or lower tier subcontractor beginning work, the Contractor shall submit to the Engineer a certification (WSDOT Form 420- 004) that a written agreement between the Contractor and the subcontractor or between the subcontractor and any lower tier subcontractor has been executed. This certification shall also guarantee that these subcontract agreements include all the documents required by the Special Provision Federal Agency Inspection. A Subcontractor or lower tier Subcontractor will not be permitted to perform any work under the contract until the following documents have been completed and submitted to the Engineer: 1. Request to Sublet Work (WSDOT Form 421-012), and 2. Contractor and Subcontractor or Lower Tier Subcontractor Certification for Federal-aid Projects (WSDOT Form 420-004). The Contractor shall submit to the Engineer a completed Monthly Retainage Report (WSDOT Form 272-065) within 15 calendar days after receipt of every monthly progress payment until every Subcontractor and lower tier Subcontractor’s retainage has been released. The ninth paragraph, beginning with “On all projects, …” is revised to read: 212th St. Preservation/Holcomb SP - 55 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Contractor shall certify to the actual amount received from the Contracting Agency and amounts paid to all firms that were used as Subcontractors, lower tier subcontractors, manufacturers, regular dealers, or service providers on the Contract. This includes all Disadvantaged, Minority, Small, Veteran or Women’s Business Enterprise firms. This Certification shall be submitted to the Engineer on a monthly basis each month between Execution of the Contract and Physical Completion of the Contract using the application available at: https://wsdot.diversitycompliance.com. A monthly report shall be submitted for every month between Execution of the Contract and Physical Completion regardless of whether payments were made or work occurred. 1-08.3(2)B Type B Progress Schedule (March 13, 2012 APWA GSP) Revise the first paragraph to read: The Contractor shall submit a preliminary Type B Progress Schedule at or prior to the preconstruction conference. The preliminary Type B Progress Schedule shall comply with all of these requirements and the requirements of Section 1-08.3(1), except that it may be limited to only those activities occurring within the first 60- working days of the project. Revise the first sentence of the second paragraph to read: The Contractor shall submit 5 copies of a Type B Progress Schedule depicting the entire project no later than 21-calendar days after the preconstruction conference. 1-08.4 Prosecution of Work Delete this section and replace it with the following: 1-08.4 Notice to Proceed and Prosecution of Work (July 23, 2015 APWA GSP) Notice to Proceed will be given after the contract has been executed and the contract bond and evidence of insurance have been approved and filed by the Contracting Agency. The Contractor shall not commence with the work until the Notice to Proceed has been given by the Engineer. The Contractor shall commence construction activities on the project site within ten days of the Notice to Proceed Date, unless otherwise approved in writing. The Contractor shall diligently pursue the work to the physical completion date within the time specified in the contract. Voluntary shutdown or slowing of operations by the Contractor shall not relieve the Contractor of the responsibility to complete the work within the time(s) specified in the contract. When shown in the Plans, the first order of work shall be the installation of high visibility fencing to delineate all areas for protection or restoration, as described in the Contract. Installation of high visibility fencing adjacent 212th St. Preservation/Holcomb SP - 56 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 to the roadway shall occur after the placement of all necessary signs and traffic control devices in accordance with 1-10.1(2). Upon construction of the fencing, the Contractor shall request the Engineer to inspect the fence. No other work shall be performed on the site until the Contracting Agency has accepted the installation of high visibility fencing, as described in the Contract. 1-08.5 Time for Completion (November 30, 2018 APWA GSP, Option A) Revise the third and fourth paragraphs to read: Contract time shall begin on the first working day following the Notice to Proceed Date. Each working day shall be charged to the contract as it occurs, until the contract work is physically complete. If substantial completion has been granted and all the authorized working days have been used, charging of working days will cease. Each week the Engineer will provide the Contractor a statement that shows the number of working days: (1) charged to the contract the week before; (2) specified for the physical completion of the contract; and (3) remaining for the physical completion of the contract. The statement will also show the nonworking days and any partial or whole day the Engineer declares as unworkable. Within 10 calendar days after the date of each statement, the Contractor shall file a written protest of any alleged discrepancies in it. To be considered by the Engineer, the protest shall be in sufficient detail to enable the Engineer to ascertain the basis and amount of time disputed. By not filing such detailed protest in that period, the Contractor shall be deemed as having accepted the statement as correct. If the Contractor is approved to work 10 hours a day and 4 days a week (a 4-10 schedule) and the fifth day of the week in which a 4-10 shift is worked would ordinarily be charged as a working day then the fifth day of that week will be charged as a working day whether or not the Contractor works on that day. Revise the sixth paragraph to read: The Engineer will give the Contractor written notice of the completion date of the contract after all the Contractor’s obligations under the contract have been performed by the Contractor. The following events must occur before the Completion Date can be established: 1. The physical work on the project must be complete; and 2. The Contractor must furnish all documentation required by the contract and required by law, to allow the Contracting Agency to process final acceptance of the contract. The following documents must be received by the Project Engineer prior to establishing a completion date: a. Certified Payrolls (per Section 1-07.9(5)). b. Material Acceptance Certification Documents c. Monthly Reports of Amounts Credited as DBE Participation, as 212th St. Preservation/Holcomb SP - 57 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 required by the Contract Provisions. d. Final Contract Voucher Certification e. Copies of the approved “Affidavit of Prevailing Wages Paid” for the Contractor and all Subcontractors f. A copy of the Notice of Termination sent to the Washington State Department of Ecology (Ecology); the elapse of 30 calendar days from the date of receipt of the Notice of Termination by Ecology; and no rejection of the Notice of Termination by Ecology. This requirement will not apply if the Construction Stormwater General Permit is transferred back to the Contracting Agency in accordance with Section 8- 01.3(16). g. Property owner releases per Section 1-07.24 Except in the case of emergency or unless otherwise approved by the Engineer, the normal straight time working hours for the Contractor shall be any consecutive 8-hour period between 7:00 a.m. and 6:00 p.m. Monday through Friday, unless otherwise specified in the Kent Special Provisions, with a 5-day work week, plus allowing a maximum one-hour lunch break in each working day. The normal straight time 8-hour working period for the contract shall be established at the preconstruction conference or prior to the Contractor commencing work. If a Contractor desires to perform work on holidays, Saturdays, Sundays, or before 7:00 a.m. or after 6:00 p.m. on any day, the Contractor shall apply in writing to the Engineer for permission to work those times. The Contractor shall notify the Engineer at least 48 hours in advance (72 hours in advance for weekend work) so that the Inspector's time may be scheduled. Permission to work longer than an 8-hour period between 7:00 a.m. and 6:00 p.m. is not required. For any work outside of normal straight time working hours that requires city surveyors, all reasonable efforts shall be made by the Contractor to allow time for surveying to be completed during normal straight time hours. Permission to work between the hours of 10:00 p.m. and 7:00 a.m. during weekdays and between the hours of 10:00 p.m. and 9:00 a.m. on weekends or holidays may also be subject to noise control requirements. Approval to continue work during these hours may be revoked at any time the Contractor exceeds the City’s noise control regulations. The Engineer may grant permission to work Saturdays, Sundays, holidays or other than the agreed upon normal straight time working hours, but may be subject to other conditions established by the City or Engineer. SECTION 1-08.9 IS SUPPLIMENTED WITH THE FOLLOWING: 1-08.9 Liquidated Damages (September 8, 2020 WSDOT GSP) 212th St. Preservation/Holcomb SP - 58 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Liquidated damages in the amount of $4,850 per working day will be assessed for failure to physically complete the Contract within the physical completion time specified. (******) 1-08.9 Liquidated Damages (Kent Special Provision) The City agrees to pay for 10 working days of UPRR and reimburse the contractor for 10 working days of BNSF railroad flagging as specified in section 1-07.18. Delayed completion of work within thirty (30) feet of the UPRR or BNSF and roadway surfacing within the UPRR or BNSF right-of-way will result in additional flagging expenses as well as impacts to the traveling public, increase fuel consumption, increase vehicle operating costs, increase pollution, and cause other inconveniences and harm. Accordingly, the Contractor agrees: 1. To pay the agency for all additional costs for railroad flagging created by the delay and an additional $500 liquidated damages per day for each day that the work is not completed as specified in section 1-07.18 of the special provisions. 2. To authorize the Engineer to deduct these liquidated damages from any money due or coming due the Contractor. 1-09 MEASUREMENT AND PAYMENT 1-09.6 Force Account (October 10, 2008 APWA GSP) Supplement this section with the following: The Contracting Agency has estimated and included in the Proposal, dollar amounts for all items to be paid per force account, only to provide a common proposal for Bidders. All such dollar amounts are to become a part of Contractor's total bid. However, the Contracting Agency does not warrant expressly or by implication, that the actual amount of work will correspond with those estimates. Payment will be made on the basis of the amount of work actually authorized by Engineer. 1-09.9(1) Retainage (June 27, 2011) Section 1-09.9(1) content and title is deleted and replaced with the following: Vacant 1-09.11 Disputes and Claims 1-09.11(3) Time Limitation and Jurisdiction (November 30, 2018 APWA GSP) Revise this section to read: 212th St. Preservation/Holcomb SP - 59 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 For the convenience of the parties to the Contract it is mutually agreed by the parties that any claims or causes of action which the Contractor has against the Contracting Agency arising from the Contract shall be brought within 180 calendar days from the date of final acceptance (Section 1-05.12) of the Contract by the Contracting Agency; and it is further agreed that any such claims or causes of action shall be brought only in the Superior Court of the county where the Contracting Agency headquarters is located, provided that where an action is asserted against a county, RCW 36.01.050 shall control venue and jurisdiction. The parties understand and agree that the Contractor’s failure to bring suit within the time period provided, shall be a complete bar to any such claims or causes of action. It is further mutually agreed by the parties that when any claims or causes of action which the Contractor asserts against the Contracting Agency arising from the Contract are filed with the Contracting Agency or initiated in court, the Contractor shall permit the Contracting Agency to have timely access to any records deemed necessary by the Contracting Agency to assist in evaluating the claims or action. 1-10 TEMPORARY TRAFFIC CONTROL 1-10.2 Traffic Control Management 1-10.2(1) General Section 1-10.2(1) is supplemented with the following: (January 3, 2017 WSDOT GSP) Only training with WSDOT TCS card and WSDOT training curriculum is recognized in the State of Washington. The Traffic Control Supervisor shall be certified by one of the following: The Northwest Laborers-Employers Training Trust 27055 Ohio Ave. Kingston, WA 98346 (360) 297-3035 Evergreen Safety Council 12545 135th Ave. NE Kirkland, WA 98034-8709 1-800-521-0778 The American Traffic Safety Services Association 15 Riverside Parkway, Suite 100 Fredericksburg, Virginia 22406-1022 Training Dept. Toll Free (877) 642-4637 Phone: (540) 368-1701 1-10.3(1)B Other Traffic Control Labor (August 21, 2020, Kent GSP) Section 1-10.3(1)B is supplemented with the following: 212th St. Preservation/Holcomb SP - 60 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Uniformed Police Officer Definitions: Uniformed Police Officer as used in this specification is a “General Authority Washington Peace Officer” as defined by RCW 10.93.020 (3), or a “Specially Commissioned Washington Peace Officer” as defined by RCW 10.93.020(5). Law Enforcement Agency as used in this specification is a “General Authority Washington Law Enforcement Agency” as defined by RCW 10.93.020 (1). The Contractor shall arrange for off-duty Uniformed Police Officers to be present for the following activities: 1. Countermanding a traffic signal indication at a signalized intersection. 2. Directing vehicle and pedestrian traffic when a traffic signal indication is turned off or is inoperative. 3. Where the Engineer deems it necessary for safety, including work during hours of darkness. It shall be the Contractor’s responsibility to secure the off duty Uniformed Police Officer services required by the contract, including the costs to arrange for and supervise the service. The following contact information for potential service providers is supplied for the Contractor’s convenience: City of Kent Police Contact: Sgt. Matt Stansfield Phone: (253)856-5809 Washington State Patrol Contact: Nancy King 811 Roanoke Street Seattle WA 98102 Phone: (206) 720-3021 Email: Nancy.king@wsp.wa.gov The services provided under the bid item “Uniformed Police Officer” shall be considered a subcontract with the attendant requirements and responsibilities. The Contractor must obtain prior approval for use of off-duty Uniformed Police Officers through their Approved Traffic Control Plan and approved amendments to the Plan. The off-duty Uniformed Police Officer shall be in addition to all other personnel required for flagging according to the approved traffic control plan. A Uniformed Police Officer shall be provided in the event of accidental power outages or disruption of a signalized intersection as a result of Contractor’s Work and remain in place until the intersection becomes satisfactorily operational as determined by City of Kent Traffic Engineer or his/her representative. 1-10.4(2) Item Bids With Lump Sum for Incidentals (August 21, 2020, Kent GSP) 212th St. Preservation/Holcomb SP - 61 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Section 1-10.4(2) is supplemented with the following: “Uniformed Police Officer” will be measured by the hour. Hours will be measured for each fully equipped Uniformed Police Officer, including vehicle, if required, directing or monitoring traffic, as shown on an approved Traffic Control Plan or as directed by the Engineer and in accordance with Section 1-10.3(1)B of these Special provisions. 1-10.5(2) Item Bids with Lump Sum for Incidentals (August 21, 2020, Kent GSP) Section 1-10.5(2) is supplemented with the following: “Uniformed Police Officer”, per hour The unit contract price for “Uniformed Police Officer”, per hour for this item in accordance with Section 1-10.4(2), shall be full compensation for all costs incurred by the Contractor in performing the Contract Work defined in Section 1-10.3(1)B of these Special Provisions, including all costs for arrangement for and supervision of uniformed law enforcement personnel and vehicles to participate in the Contractor’s traffic control activities. 212th St. Preservation/Holcomb SP - 62 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 2 – EARTHWORK 2-02 REMOVAL OF STRUCTURES AND OBSTRUCTIONS SECTION 2-02.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-02.1 Description (Kent Special Provision) This work also includes the repair of adjacent improvements that were not designated for removal, but that were damaged by the Contractor’s operations. SECTION 2-02.3 IS REVISED BY REPLACING THE LAST THREE PARAGRAPHS WITH THE FOLLOWING: (******) 2-02.3 Construction Requirements (Kent Special Provision) All improvements that are not designated for removal, but that are damaged by the Contractor’s operations shall be replaced, restored, or repaired at the Contractor’s sole expense. The Engineer’s determination regarding what replacement, restoration, or repair must be made by the Contractor to repair damage caused by the Contractor’s removal operations is final. SECTION 2-02.3(3) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 2-02.3(3) Removal of Pavement, Sidewalks, Curbs, and Gutters (Kent Special Provision) In removing pavement, sidewalks, and curbs the Contractor shall: 1. Haul broken-up pieces of concrete and asphalt pavement into the roadway embankment, or to some off-project site, unless otherwise directed by the Engineer, or permitted by the Kent Special Provisions. 2. Material that is to be incorporated into the embankment shall be broken into pieces not exceeding 18 inches in any dimension, and no part of any piece shall be within three feet of the top, side or end surface of the embankment or any structure. 3. Make a vertical saw cut between any existing pavement, sidewalk, or curb that is to remain and the portion to be removed. When asphalt pavements are being widened, the vertical saw cut shall be made at least 1-foot from the edge of the existing pavement, and at least 2-feet from the closest edge of any cement concrete curb that will remain or be replaced, unless otherwise directed by the Engineer. 212th St. Preservation/Holcomb SP - 63 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 4. Replace at no expense to the City any existing pavement designated to remain that is damaged during the removal of other pavement, sidewalks, or curbs. 5. When cement concrete sidewalk, cement concrete pavement, or cement concrete curb is being removed, and the removal would result in a remaining strip of cement concrete less than 5 feet long, or where in the opinion of the Engineer the remaining portion of the sidewalk, pavement or curb would be damaged by the cutting required for the removal, then the entire sidewalk, pavement or curb shall be removed to the next expansion joint. SECTION 2-02.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 2-02.3(4) Removal of Traffic Islands, and/or Traffic Curbs When Pavement Surface Integrity is to be Maintained (Kent Special Provision) New Section In removing traffic islands and/or traffic curbs the Contractor shall: 1. Haul broken-up pieces and complete sections of traffic curbs and all waste materials to an off-project site, unless otherwise directed by the Engineer, or permitted by the Kent Special Provisions. 2. Completely remove all block traffic curbs, pre-cast traffic curbs, connecting dividers, nose pieces and remaining adhesive. 3. Remove all island materials, including asphalt pavement, crushed rock, and topsoil, between the traffic curbs to the depth of the compacted subgrade, or to the surface of the underlying pavement where such pavement exists under the island. 4. Take suitable care so as not to damage the underlying pavement surface more than necessary, clean all underlying pavement, and fill any surface voids caused by the removal work. 5. Repair any damage to adjacent traffic curbs that were designated to remain, but that was caused by the removal of the traffic curbs. 6. Remove and dispose of all waste materials deposited on the pavement, or within the City’s stormwater management system, as a result of the removal process selected by the Contractor. SECTION 2-02.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-02.5 Payment (Kent Special Provision) Payment will be made in accordance with Section 1-04.1, for the following bid items when they are included in the Proposal: The unit contract price per square yard for “Remove Existing Asphalt Concrete Pavement” constitutes complete compensation for all labor, materials, tools, supplies and equipment required to remove existing asphalt from sidewalk for a depth of 3 inches, and from roads for a depth of 8 inches. Included in this price is 212th St. Preservation/Holcomb SP - 64 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 the cost of hauling and disposal of the asphalt pavement. Should the Contractor encounter pavement to be removed which is thicker than 8 inches it shall be paid according to the following formula: actual depth in inches (square yards) x 8 inches = quantity For example, if the Contractor encounters pavement to be removed which is 8 inches thick and 100 square yards then the quantity would be: 10 100’ x 8 = 125 S.Y. No other compensation shall be allowed. The unit contract price per square yard for “Remove Existing Reinforced Cement Concrete Driveway/Pavement” constitutes complete compensation for all labor, materials, tools, supplies and equipment required to remove existing concrete pavement from roads for a depth of 8 inches. Included in this price is the cost of hauling and disposal of the concrete pavement. Should the Contractor encounter pavement to be removed which is thicker than 8 inches it shall be paid according to the following formula: actual depth in inches (square yards) x 8 inches = quantity For example, if the Contractor encounters pavement to be removed which is 10 inches thick and 100 square yards then the quantity would be: 10 100’ x 8 = 125 S.Y. No other compensation shall be allowed. The unit contract price per square yard for “Remove Cement Concrete Sidewalk” constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to saw cut and remove, haul, and dispose of the cement concrete sidewalk as shown on the plans and described in the specifications. The unit contract price per lineal foot for “Remove Cement Concrete Curb and Gutter” constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to saw cut and remove, haul, and dispose of the cement concrete curb and gutter as shown on the plans and described in the specifications. Note, curb and gutter adjacent to driveway may contain rebar and shall be removed and included in the cost of this bid item. “Removal of Traffic Islands and/or Traffic Curb,” lineal feet. The unit price contract price per lineal foot for “Saw Cut Existing Asphalt Concrete Pavement” constitutes complete compensation for all materials, labor and equipment required to saw cut existing pavement to a depth of 8 inches in accordance with the plans and specifications. Should the Contractor encounter pavement to be removed which is thicker than 8 inches, it shall be paid according to the following formula: 212th St. Preservation/Holcomb SP - 65 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 actual depth in inches (square yards) x 8 inches = quantity For example, if the Contractor encounters pavement to be saw cut which is 10 inches thick and 100 linear feet then the quantity would be: 10 100’ x 8 = 125 S.Y. No other compensation shall be allowed. A vertical saw cut shall be required between any existing pavement, sidewalk, or curb that is to remain and the portion to be removed. The costs of other types of pavement cutting, such as “wheel cutting”, shall be considered incidental to other bid items and no payment will be allowed under this item unless the pavement is actually saw cut. The unit price contract price per lineal foot for “Saw Cut Existing Cement Concrete Sidewalk/Gutter” constitutes complete compensation for all materials, labor and equipment required to saw cut existing sidewalk or cement concrete gutter including cement concrete reinforced with rebar to a depth of 6 inches in accordance with the plans and specifications. Should the Contractor encounter pavement to be removed which is thicker than 6 inches, it shall be paid according to the following formula: actual depth in inches (length) x 6 inches = quantity For example, if the Contractor encounters pavement to be saw cut which is 8 inches thick and 100 linear feet then the quantity would be: 8 length x 6 = 133 LF. No other compensation shall be allowed. A vertical saw cut shall be required between any existing pavement, sidewalk, or curb that is to remain and the portion to be removed. The costs of other types of pavement cutting, such as “wheel cutting”, shall be considered incidental to other bid items and no payment will be allowed under this item unless the pavement is actually saw cut. 2-03 ROADWAY EXCAVATION AND EMBANKMENT 2-03.3 Construction Requirements SECTION 2-03.3(7)C IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-03.3(7)C Contractor-Provided Disposal Site (Kent Special Provision) 212th St. Preservation/Holcomb SP - 66 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The City has not provided a waste site. The Contractor shall arrange for disposal and provide any necessary disposal sites in accordance with Section 2-03.3(7)C of the WSDOT Standard Specifications. The Contractor is responsible for determining which permits are required for the selected disposal sites. Within the City, wetlands are identified by using the Corps of Engineers Wetlands Delineation Manual dated January 1987. SECTION 2-03.3(14)D IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-03.3(14)D Compaction and Moisture Control Tests (Kent Special Provision) Maximum density will be determined by the Modified Proctor Method ASTM D- 1557. All compaction tests if required will be performed by the City. 2-06 SUBGRADE PREPARATION 2-06.3 Construction Requirements SECTION 2-06.3(1) ITEM 6 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 2-06.3(1) Subgrade for Surfacing (Kent Special Provision) 6. The prepared subgrade shall be compacted in the top 0.50 foot to 95 percent of maximum dry density per ASTM D-1557 for a cut section. If the underlying subgrade is too soft to permit compaction of the upper 0.5 foot layer, the Contractor shall loosen (or excavate and remove), and compact the subgrade until the top layer can meet compaction requirements. Fill sections shall be prepared in accordance with the Standard Specification Section 2-03.3(14)C, Method B except ASTM D-1557 shall determine the maximum density. SECTION 2-06.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-06.5 Measurement and Payment (Kent Special Provision) The cost for work required for compaction of the subgrade shall be included by the Contractor in the unit contract price of other bid items. 212th St. Preservation/Holcomb SP - 67 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 2-07 WATERING SECTION 2-07.4 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 2-07.4 Measurement (Kent Special Provision) The Contractor shall obtain a hydrant meter and permit from the City Maintenance Shop located at 5821 South 240th Street 253-856-5600 to measure the quantities of water used. Hydrant wrenches are also available at the City Maintenance Shops at the Contractors option. No additional deposit is required for the hydrant wrench. The City shall provide all water that comes from the City water system. Prior to issuance of the hydrant meter (and wrench if applicable) and permit, the Contractor shall make a hydrant meter deposit to the City Customer Service Division located on the first floor of the Centennial Center at 400 West Gowe Street 253-856-5200. The said deposit is refundable provided the Contractor returns the hydrant meter (and wrench if applicable) to the City Maintenance Shops undamaged. The Contractor shall provide his own gate valve on the hose side of the hydrant meter with which to control water flow. The hydrant meter permit duration is two (2) months. At the end of the permit duration, the Contractor shall deliver the hydrant meter (and wrench if applicable) to the City Maintenance Shops for reading. If the Contractor requires another hydrant meter and permit at the time a meter is returned to the City Maintenance Shops, he shall request a meter and one shall be provided. An additional meter deposit will not be required. The Contractors initial hydrant meter deposit shall be transferred to the new meter issued. SECTION 2-07.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 2-07.5 Payment (Kent Special Provision) The unit contract price per hour for “Watering” shall be complete compensation for all labor, equipment, supplies, tools and materials to haul, deliver and distribute water on construction site as required to control dust or street cleaning. Quantities used for all other work including but not limited to: concrete work, hydroseeding and plant establishment, and compaction shall be included in the appropriate bid items. 2-09 STRUCTURE EXCAVATION SECTION 2-09.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: 2-09.3(1) General Requirements 212th St. Preservation/Holcomb SP - 68 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (Kent Special Provision) The Contractor shall be responsible for any and all cribbing, sheet piling, shoring, dewatering, or other construction methods or procedures that may be necessary to complete the project, and additional compensation will not be allowed. SECTION 2-09.3(3)D IS SUPPLEMENTED BY ADDING THE FOLLOWING: (August 2, 2010) The Contractor shall protect the existing track and facilities of the Railroad Company from damage due to the Contractor's operations, and shall shore all excavation adjacent to the existing railroad track. Shoring shall be steel sheet piling designed for a Cooper E-80 loading according to the American Railway Engineering and Maintenance Association (AREMA) Manual For Railway Engineering. Damage to the railroad track or railroad facilities, due to the Contractor's operations, will be repaired as directed by the Railroad at the Contractor's expense. 212th St. Preservation/Holcomb SP - 69 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 4 – BASES DIVISION 4 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: 4-03 GRAVEL BORROW (******) 4-03.1 Description (Kent Special Provision) New Section This work shall consist of constructing one or more layers of gravel borrow upon a prepared subgrade in accordance with these specifications and in conformity with the lines, grades, depths, and typical cross-section shown in the plans or as established by the Engineer. (******) 4-03.2 Materials (Kent Special Provision) New Section Materials shall meet the minimum requirements of the following section in the Kent Special Provisions: Gravel Borrow ................... 9-03.14(1) (******) 4-03.3 Construction Requirements (Kent Special Provision) New Section Gravel borrow shall be uniformly spread upon the prepared subgrade to the depth, width, and cross-sections shown in the plans. Construction methods used shall meet the appropriate requirements of Section 4-04.3. (******) 4-03.4 Measurement (Kent Special Provision) New Section Gravel borrow will be measured in the same manner prescribed for the measurement of crushed surfacing materials as set forth in Section 4-04.4. (******) 4-03.5 Payment (Kent Special Provision) New Section Payment will be made in accordance with Section 1-04.1, for the following bid item when they are included in the Proposal: 212th St. Preservation/Holcomb SP - 70 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The unit contract price per ton for “Gravel Borrow, Including Haul and Compaction” constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to haul, place, finish grade, and compact the gravel borrow as shown on the plans and described in the specifications. This item shall be used for roadway subbase, backfill for water, storm sewer, electrical conduit trenches, and other excavation backfill and compaction unless otherwise noted. 4-04 BALLAST AND CRUSHED SURFACING 4-04.3 Construction Requirements SECTION 4-04.3(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 4-04.3(2) Subgrade (Kent Special Provision) The Contractor is responsible for any delays or costs incurred as a result of placing ballast or surface materials before approval is received from the Engineer. SECTION 4-04.3(5) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 4-04.3(5) Shaping and Compaction (Kent Special Provision) Surfacing shall be compacted in depths not to exceed 6 inches except top course shall not exceed 2 inches unless otherwise directed. Density shall be at least 95 percent of maximum density per ASTM D-1557 using a nuclear gauge. Compaction of each layer must be approved by the Engineer before the next succeeding layer of surfacing or pavement is placed thereon. SECTION 4-04.3(7) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 4-04.3(7) Miscellaneous Requirements (Kent Special Provision) The Contractor is solely responsible for any delays or additional costs incurred as a result of placing ballast or succeeding courses of surfacing materials before approval to proceed is received from the Engineer. SECTION 4-04.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 71 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 4-04.5 Payment (Kent Special Provision) “Crushed Surfacing Top Course, 5/8 Inch Minus” “Crushed Surfacing Base Course, 1-1/4 Inch Minus” The unit contract price per ton for the above items constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to haul, place, finish grade, and compact the material as shown on the plans and described in the specifications. This bid item also includes proof rolling at the locations shown on the plans or as directed by the Engineer. These items shall also be used for roadway or driveway remedial work or patching as requested by the Engineer. Quantities used for pipe zone bedding shall be measured and paid separately under the appropriate bid item. 212th St. Preservation/Holcomb SP - 72 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 5 – SURFACE TREATMENTS AND PAVEMENTS NOTE: If the contract also includes underground utility construction, permanent surface treatments and pavements shall not be placed until an as-built survey and testing of the new underground utilities have been completed. Verification that utility construction conforms to the line and grade requirements of Section 7-08.3(2)B of the WSDOT Standard Specifications shall be made by the Engineer prior to authorizing paving to begin. Also, each new utility must pass all appropriate tests specified herein for the type of utility prior to paving. 5-02 BITUMINOUS SURFACE TREATMENT SECTION 5-02.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 5-02.5 Payment (Kent Special Provision) Anti-stripping additive shall be included in the price of asphalt (grade) per ton. The quantity of asphalt material shall not be reduced by the quantity of anti- stripping additive. 5-04 HOT MIX ASPHALT SECTION 5-04 IS DELETED IN IT’S ENTIRETY AND REPLACED WIH THE FOLLOWING: 5-04.1 Description (March 5, 2018 APWA GSP) This Work shall consist of providing and placing one or more layers of plant-mixed hot mix asphalt (HMA) on a prepared foundation or base in accordance with these Specifications and the lines, grades, thicknesses, and typical cross-sections shown in the Plans. The manufacture of HMA may include warm mix asphalt (WMA) processes in accordance with these Specifications. WMA processes include organic additives, chemical additives, and foaming. HMA shall be composed of asphalt binder and mineral materials as may be required, mixed in the proportions specified to provide a homogeneous, stable, and workable mixture. 5-04.2 Materials (March 5, 2018 APWA GSP) Materials shall meet the requirements of the following sections: Asphalt Binder 9-02.1(4) Cationic Emulsified Asphalt 9-02.1(6) Anti-Stripping Additive 9-02.4 HMA Additive 9-02.5 Aggregates 9-03.8 212th St. Preservation/Holcomb SP - 73 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Recycled Asphalt Pavement 9-03.8(3)B Mineral Filler 9-03.8(5) Recycled Material 9-03.21 Portland Cement 9-01 Sand 9-03.1(2). (As noted in 5-04.3(5)C for crack sealing) Joint Sealant 9-04.2 Foam Backer Rod 9-04.2(3)A The Contract documents may establish that the various mineral materials required for the manufacture of HMA will be furnished in whole or in part by the Contracting Agency. If the documents do not establish the furnishing of any of these mineral materials by the Contracting Agency, the Contractor shall be required to furnish such materials in the amounts required for the designated mix. Mineral materials include coarse and fine aggregates, and mineral filler. The Contractor may choose to utilize recycled asphalt pavement (RAP) in the production of HMA. The RAP may be from pavements removed under the Contract, if any, or pavement material from an existing stockpile. The Contractor may use up to 20 percent RAP by total weight of HMA with no additional sampling or testing of the RAP. The RAP shall be sampled and tested at a frequency of one sample for every 1,000 tons produced and not less than ten samples per project. The asphalt content and gradation test data shall be reported to the Contracting Agency when submitting the mix design for approval on the QPL. The Contractor shall include the RAP as part of the mix design as defined in these Specifications. The grade of asphalt binder shall be as required by the Contract. Blending of asphalt binder from different sources is not permitted. The Contractor may only use warm mix asphalt (WMA) processes in the production of HMA with 20 percent or less RAP by total weight of HMA. The Contractor shall submit to the Engineer for approval the process that is proposed and how it will be used in the manufacture of HMA. Production of aggregates shall comply with the requirements of Section 3-01. Preparation of stockpile site, the stockpiling of aggregates, and the removal of aggregates from stockpiles shall comply with the requirements of Section 3-02. (******) ESAL's The minimum number of ESAL's for the design and acceptance of the HMA in the contract shall be 11 million. 5-04.2(1) How to Get an HMA Mix Design on the QPL (March 5, 2018 APWA GSP) If the contractor wishes to submit a mix design for inclusion in the Qualified Products List (QPL), please follow the WSDOT process outlined in Standard Specification 5-04.2(1). 212th St. Preservation/Holcomb SP - 74 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-04.2(1)A Vacant 5-04.2(2) Mix Design – Obtaining Project Approval (March 5, 2018 APWA GSP) No paving shall begin prior to the approval of the mix design by the Engineer. Nonstatistical evaluation will be used for all HMA not designated as Commercial HMA in the contract documents. Commercial evaluation will be used for Commercial HMA and for other classes of HMA in the following applications: sidewalks, road approaches, ditches, slopes, paths, trails, gores, prelevel, and pavement repair. Other nonstructural applications of HMA accepted by commercial evaluation shall be as approved by the Project Engineer. Sampling and testing of HMA accepted by commercial evaluation will be at the option of the Project Engineer. The Proposal quantity of HMA that is accepted by commercial evaluation will be excluded from the quantities used in the determination of nonstatistical evaluation. Nonstatistical Mix Design. Fifteen days prior to the first day of paving the contractor shall provide one of the following mix design verification certifications for Contracting Agency review; • The WSDOT Mix Design Evaluation Report from the current WSDOT QPL, or one of the mix design verification certifications listed below. • The proposed HMA mix design on WSDOT Form 350-042 with the seal and certification (stamp & signature) of a valid licensed Washington State Professional Engineer. • The Mix Design Report for the proposed HMA mix design developed by a qualified City or County laboratory that is within one year of the approval date. The mix design shall be performed by a lab accredited by a national authority such as Laboratory Accreditation Bureau, L-A-B for Construction Materials Testing, The Construction Materials Engineering Council (CMEC’s) ISO 17025 or AASHTO Accreditation Program (AAP) and shall supply evidence of participation in the AASHTO: resource proficiency sample program. Mix designs for HMA accepted by Nonstatistical evaluation shall; • Have the aggregate structure and asphalt binder content determined in accordance with WSDOT Standard Operating Procedure 732 and meet the requirements of Sections 9-03.8(2), except that Hamburg testing for ruts and stripping are at the discretion of the Engineer, and 9-03.8(6). • Have anti-strip requirements, if any, for the proposed mix design determined in accordance with AASHTO T 283 or T 324, or based on historic anti-strip and aggregate source compatibility from previous WSDOT lab testing. At the discretion of the Engineer, agencies may accept verified mix designs older than 12 months from the original verification date with a certification from the Contractor that the materials and sources are the same as those shown on the original mix design. 212th St. Preservation/Holcomb SP - 75 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Commercial Evaluation Approval of a mix design for “Commercial Evaluation” will be based on a review of the Contractor’s submittal of WSDOT Form 350-042 (For commercial mixes, AASHTO T 324 evaluation is not required) or a Mix Design from the current WSDOT QPL or from one of the processes allowed by this section. Testing of the HMA by the Contracting Agency for mix design approval is not required. For the Bid Item Commercial HMA, the Contractor shall select a class of HMA and design level of Equivalent Single Axle Loads (ESAL’s) appropriate for the required use. 5-04.2(2)B Using Warm Mix Asphalt Processes The Contractor may elect to use additives that reduce the optimum mixing temperature or serve as a compaction aid for producing HMA. Additives include organic additives, chemical additives and foaming processes. The use of Additives is subject to the following: • Do not use additives that reduce the mixing temperature more than allowed in Section 5-04.3(6) in the production of mixtures. • Before using additives, obtain the Engineer’s approval using WSDOT Form 350- 076 to describe the proposed additive and process. 5-04.3 Construction Requirements 5-04.3(1) Weather Limitations (March 5, 2018 APWA GSP) Do not place HMA for wearing course on any Traveled Way beginning October 1st through March 31st of the following year without written concurrence from the Engineer. Do not place HMA on any wet surface, or when the average surface temperatures are less than those specified below, or when weather conditions otherwise prevent the proper handling or finishing of the HMA. Minimum Surface Temperature for Paving Compacted Thickness (Feet) Wearing Course Other Courses Less than 0.10 55◦F 45◦F 0.10 to .20 45◦F 35◦F More than 0.20 35◦F 35◦F 5-04.3(2) Paving Under Traffic (March 5, 2018 APWA GSP) When the Roadway being paved is open to traffic, the requirements of this Section shall apply. The Contractor shall keep intersections open to traffic at all times except when paving the intersection or paving across the intersection. During such time, and provided that there has been an advance warning to the public, the intersection 212th St. Preservation/Holcomb SP - 76 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 may be closed for the minimum time required to place and compact the mixture. In hot weather, the Engineer may require the application of water to the pavement to accelerate the finish rolling of the pavement and to shorten the time required before reopening to traffic. Before closing an intersection, advance warning signs shall be placed and signs shall also be placed marking the detour or alternate route. During paving operations, temporary pavement markings shall be maintained throughout the project. Temporary pavement markings shall be installed on the Roadway prior to opening to traffic. Temporary pavement markings shall be in accordance with Section 8-23. All costs in connection with performing the Work in accordance with these requirements, except the cost of temporary pavement markings, shall be included in the unit Contract prices for the various Bid items involved in the Contract. 5-04.3(3) Equipment (March 5, 2018 APWA GSP) 5-04.3(3)A Mixing Plant Plants used for the preparation of HMA shall conform to the following requirements: 1. Equipment for Preparation of Asphalt Binder – Tanks for the storage of asphalt binder shall be equipped to heat and hold the material at the required temperatures. The heating shall be accomplished by steam coils, electricity, or other approved means so that no flame shall be in contact with the storage tank. The circulating system for the asphalt binder shall be designed to ensure proper and continuous circulation during the operating period. A valve for the purpose of sampling the asphalt binder shall be placed in either the storage tank or in the supply line to the mixer. 2. Thermometric Equipment – An armored thermometer, capable of detecting temperature ranges expected in the HMA mix, shall be fixed in the asphalt binder feed line at a location near the charging valve at the mixer unit. The thermometer location shall be convenient and safe for access by Inspectors. The plant shall also be equipped with an approved dial-scale thermometer, a mercury actuated thermometer, an electric pyrometer, or another approved thermometric instrument placed at the discharge chute of the drier to automatically register or indicate the temperature of the heated aggregates. This device shall be in full view of the plant operator. 3. Heating of Asphalt Binder – The temperature of the asphalt binder shall not exceed the maximum recommended by the asphalt binder manufacturer nor shall it be below the minimum temperature required to maintain the asphalt binder in a homogeneous state. The asphalt binder shall be heated in a manner that will avoid local variations in heating. The heating method shall provide a continuous supply of asphalt binder to the mixer at a uniform average temperature with no individual variations exceeding 25°F. Also, when a WMA additive is included in the asphalt binder, the temperature of the asphalt binder 212th St. Preservation/Holcomb SP - 77 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 shall not exceed the maximum recommended by the manufacturer of the WMA additive. 4. Sampling and Testing of Mineral Materials – The HMA plant shall be equipped with a mechanical sampler for the sampling of the mineral materials. The mechanical sampler shall meet the requirements of Section 1-05.6 for the crushing and screening operation. The Contractor shall provide for the setup and operation of the field testing facilities of the Contracting Agency as provided for in Section 3-01.2(2). 5. Sampling HMA – The HMA plant shall provide for sampling HMA by one of the following methods: a. A mechanical sampling device attached to the HMA plant. b. Platforms or devices to enable sampling from the hauling vehicle without entering the hauling vehicle. 5-04.3(3)B Hauling Equipment Trucks used for hauling HMA shall have tight, clean, smooth metal beds and shall have a cover of canvas or other suitable material of sufficient size to protect the mixture from adverse weather. Whenever the weather conditions during the work shift include, or are forecast to include, precipitation or an air temperature less than 45°F or when time from loading to unloading exceeds 30 minutes, the cover shall be securely attached to protect the HMA. The contractor shall provide an environmentally benign means to prevent the HMA mixture from adhering to the hauling equipment. Excess release agent shall be drained prior to filling hauling equipment with HMA. Petroleum derivatives or other coating material that contaminate or alter the characteristics of the HMA shall not be used. For live bed trucks, the conveyer shall be in operation during the process of applying the release agent. 5-04.3(3)C Pavers HMA pavers shall be self-contained, power-propelled units, provided with an internally heated vibratory screed and shall be capable of spreading and finishing courses of HMA plant mix material in lane widths required by the paving section shown in the Plans. The HMA paver shall be in good condition and shall have the most current equipment available from the manufacturer for the prevention of segregation of the HMA mixture installed, in good condition, and in working order. The equipment certification shall list the make, model, and year of the paver and any equipment that has been retrofitted. The screed shall be operated in accordance with the manufacturer’s recommendations and shall effectively produce a finished surface of the required evenness and texture without tearing, shoving, segregating, or gouging the mixture. A copy of the manufacturer’s recommendations shall be provided upon request by the Contracting Agency. Extensions will be allowed provided they produce the same results, including ride, density, and surface texture as obtained 212th St. Preservation/Holcomb SP - 78 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 by the primary screed. Extensions without augers and an internally heated vibratory screed shall not be used in the Traveled Way. When specified in the Contract, reference lines for vertical control will be required. Lines shall be placed on both outer edges of the Traveled Way of each Roadway. Horizontal control utilizing the reference line will be permitted. The grade and slope for intermediate lanes shall be controlled automatically from reference lines or by means of a mat referencing device and a slope control device. When the finish of the grade prepared for paving is superior to the established tolerances and when, in the opinion of the Engineer, further improvement to the line, grade, cross- section, and smoothness can best be achieved without the use of the reference line, a mat referencing device may be substituted for the reference line. Substitution of the device will be subject to the continued approval of the Engineer. A joint matcher may be used subject to the approval of the Engineer. The reference line may be removed after the completion of the first course of HMA when approved by the Engineer. Whenever the Engineer determines that any of these methods are failing to provide the necessary vertical control, the reference lines will be reinstalled by the Contractor. The Contractor shall furnish and install all pins, brackets, tensioning devices, wire, and accessories necessary for satisfactory operation of the automatic control equipment. If the paving machine in use is not providing the required finish, the Engineer may suspend Work as allowed by Section 1-08.6. Any cleaning or solvent type liquids spilled on the pavement shall be thoroughly removed before paving proceeds. 5-04.3(3)D Material Transfer Device or Material Transfer Vehicle A Material Transfer Device/Vehicle (MTD/V) shall only be used with the Engineer’s approval, unless otherwise required by the contract. Where an MTD/V is required by the contract, the Engineer may approve paving without an MTD/V, at the request of the Contractor. The Engineer will determine if an equitable adjustment in cost or time is due. When used, the MTD/V shall mix the HMA after delivery by the hauling equipment and prior to laydown by the paving machine. Mixing of the HMA shall be sufficient to obtain a uniform temperature throughout the mixture. If a windrow elevator is used, the length of the windrow may be limited in urban areas or through intersections, at the discretion of the Engineer. To be approved for use, an MTV: 1. Shall be self-propelled vehicle, separate from the hauling vehicle or paver. 2. Shall not be connected to the hauling vehicle or paver. 3. May accept HMA directly from the haul vehicle or pick up HMA from a windrow. 4. Shall mix the HMA after delivery by the hauling equipment and prior to placement into the paving machine. 5. Shall mix the HMA sufficiently to obtain a uniform temperature throughout the mixture. 212th St. Preservation/Holcomb SP - 79 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 To be approved for use, an MTD: 1. Shall be positively connected to the paver. 2. May accept HMA directly from the haul vehicle or pick up HMA from a windrow. 3. Shall mix the HMA after delivery by the hauling equipment and prior to placement into the paving machine. 4. Shall mix the HMA sufficiently to obtain a uniform temperature throughout the mixture. (******) This project requires the use of MTD/V when placing wearing course of the pavement section used in traffic lanes of S. 212th St. However, an MTD/V is not required for pavement repair below the 2” grind, HMA placed in regular shaped and minor areas such as tapers and turn lanes. 5-04.3(3)E Rollers Rollers shall be of the steel wheel, vibratory, oscilatory, or pneumatic tire type, in good condition and capable of reversing without backlash. Operation of the roller shall be in accordance with the manufacturer’s recommendations. When ordered by the Engineer for any roller planned for use on the project, the Contractor shall provide a copy of the manufacturer’s recommendation for the use of that roller for compaction of HMA. The number and weight of rollers shall be sufficient to compact the mixture in compliance with the requirements of Section 5-04.3(10). The use of equipment that results in crushing of the aggregate will not be permitted. Rollers producing pickup, washboard, uneven compaction of the surface, displacement of the mixture or other undesirable results shall not be used. 5-04.3(4) Preparation of Existing Paved Surfaces (March 5, 2018 APWA GSP) When the surface of the existing pavement or old base is irregular, the Contractor shall bring it to a uniform grade and cross-section as shown on the Plans or approved by the Engineer. Preleveling of uneven or broken surfaces over which HMA is to be placed may be accomplished by using an asphalt paver, a motor patrol grader, or by hand raking, as approved by the Engineer. Compaction of preleveling HMA shall be to the satisfaction of the Engineer and may require the use of small steel wheel rollers, plate compactors, or pneumatic rollers to avoid bridging across preleveled areas by the compaction equipment. Equipment used for the compaction of preleveling HMA shall be approved by the Engineer. Before construction of HMA on an existing paved surface, the entire surface of the pavement shall be clean. All fatty asphalt patches, grease drippings, and other objectionable matter shall be entirely removed from the existing pavement. All pavements or bituminous surfaces shall be thoroughly cleaned of dust, soil, pavement grindings, and other foreign matter. All holes and small depressions shall be filled with an appropriate class of HMA. The surface of the patched area shall be leveled and compacted thoroughly. Prior to the application of tack coat, or 212th St. Preservation/Holcomb SP - 80 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 paving, the condition of the surface shall be approved by the Engineer. A tack coat of asphalt shall be applied to all paved surfaces on which any course of HMA is to be placed or abutted; except that tack coat may be omitted from clean, newly paved surfaces at the discretion of the Engineer. Tack coat shall be uniformly applied to cover the existing pavement with a thin film of residual asphalt free of streaks and bare spots at a rate between 0.02 and 0.10 gallons per square yard of retained asphalt. The rate of application shall be approved by the Engineer. A heavy application of tack coat shall be applied to all joints. For Roadways open to traffic, the application of tack coat shall be limited to surfaces that will be paved during the same working shift. The spreading equipment shall be equipped with a thermometer to indicate the temperature of the tack coat material. Equipment shall not operate on tacked surfaces until the tack has broken and cured. If the Contractor’s operation damages the tack coat it shall be repaired prior to placement of the HMA. The tack coat shall be CSS-1, or CSS-1h emulsified asphalt. The CSS-1 and CSS- 1h emulsified asphalt may be diluted once with water at a rate not to exceed one part water to one part emulsified asphalt. The tack coat shall have sufficient temperature such that it may be applied uniformly at the specified rate of application and shall not exceed the maximum temperature recommended by the emulsified asphalt manufacturer. 5-04.3(4)A Crack Sealing 5-04.3(4)A1 General When the Proposal includes a pay item for crack sealing, seal all cracks ¼ inch in width and greater. Cleaning: Ensure that cracks are thoroughly clean, dry and free of all loose and foreign material when filling with crack sealant material. Use a hot compressed air lance to dry and warm the pavement surfaces within the crack immediately prior to filling a crack with the sealant material. Do not overheat pavement. Do not use direct flame dryers. Routing cracks is not required. Sand Slurry: For cracks that are to be filled with sand slurry, thoroughly mix the components and pour the mixture into the cracks until full. Add additional CSS-1 cationic emulsified asphalt to the sand slurry as needed for workability to ensure the mixture will completely fill the cracks. Strike off the sand slurry flush with the existing pavement surface and allow the mixture to cure. Top off cracks that were not completely filled with additional sand slurry. Do not place the HMA overlay until the slurry has fully cured. The sand slurry shall consist of approximately 20 percent CSS-1 emulsified asphalt, approximately 2 percent portland cement, water (if required), and the remainder clean Class 1 or 2 fine aggregate per section 9-03.1(2). The components shall be thoroughly mixed and then poured into the cracks and joints until full. The following day, any cracks or joints that are not completely filled shall be topped off with additional sand slurry. After the sand slurry is placed, the filler shall be struck off flush with the existing pavement surface and allowed to cure. The HMA overlay 212th St. Preservation/Holcomb SP - 81 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 shall not be placed until the slurry has fully cured. The requirements of Section 1- 06 will not apply to the portland cement and sand used in the sand slurry. In areas where HMA will be placed, use sand slurry to fill the cracks. In areas where HMA will not be placed, fill the cracks as follows: 1. Cracks ¼ inch to 1 inch in width - fill with hot poured sealant. 2. Cracks greater than 1 inch in width – fill with sand slurry. Hot Poured Sealant: For cracks that are to be filled with hot poured sealant, apply the material in accordance with these requirements and the manufacturer’s recommendations. Furnish a Type 1 Working Drawing of the manufacturer’s product information and recommendations to the Engineer prior to the start of work, including the manufacturer’s recommended heating time and temperatures, allowable storage time and temperatures after initial heating, allowable reheating criteria, and application temperature range. Confine hot poured sealant material within the crack. Clean any overflow of sealant from the pavement surface. If, in the opinion of the Engineer, the Contractor’s method of sealing the cracks with hot poured sealant results in an excessive amount of material on the pavement surface, stop and correct the operation to eliminate the excess material. 5-04.3(4)A2 Crack Sealing Areas Prior to Paving In areas where HMA will be placed, use sand slurry to fill the cracks. 5-04.3(4)A3 Crack Sealing Areas Not to be Paved In areas where HMA will not be placed, fill the cracks as follows: a. Cracks ¼ inch to 1 inch in width - fill with hot poured sealant. b. Cracks greater than 1 inch in width – fill with sand slurry. 5-04.3(4)B Vacant 5-04.3(4)C Pavement Repair The Contractor shall excavate pavement repair areas and shall backfill these with HMA in accordance with the details shown in the Plans and as marked in the field. The Contractor shall conduct the excavation operations in a manner that will protect the pavement that is to remain. Pavement not designated to be removed that is damaged as a result of the Contractor’s operations shall be repaired by the Contractor to the satisfaction of the Engineer at no cost to the Contracting Agency. The Contractor shall excavate only within one lane at a time unless approved otherwise by the Engineer. The Contractor shall not excavate more area than can be completely finished during the same shift, unless approved by the Engineer. Unless otherwise shown in the Plans or determined by the Engineer, excavate to a depth of 1.0 feet. The Engineer will make the final determination of the excavation depth required. The minimum width of any pavement repair area shall be 40 inches unless shown otherwise in the Plans. Before any excavation, the existing pavement shall be sawcut or shall be removed by a pavement grinder. Excavated materials will become the property of the Contractor and shall be disposed of in a Contractor-provided site off the Right of Way or used in accordance with Sections 212th St. Preservation/Holcomb SP - 82 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 2-02.3(3) or 9-03.21. Asphalt for tack coat shall be required as specified in Section 5-04.3(4). A heavy application of tack coat shall be applied to all surfaces of existing pavement in the pavement repair area. Placement of the HMA backfill shall be accomplished in lifts not to exceed 0.35-foot compacted depth. Lifts that exceed 0.35-foot of compacted depth may be accomplished with the approval of the Engineer. Each lift shall be thoroughly compacted by a mechanical tamper or a roller. 5-04.3(5) Producing/Stockpiling Aggregates and RAP (March 5, 2018 APWA GSP) Aggregates and RAP shall be stockpiled according to the requirements of Section 3- 02. Sufficient storage space shall be provided for each size of aggregate and RAP. Materials shall be removed from stockpile(s) in a manner to ensure minimal segregation when being moved to the HMA plant for processing into the final mixture. Different aggregate sizes shall be kept separated until they have been delivered to the HMA plant. 5-04.3(5)A Vacant 5-04.3(6) Mixing (March 5, 2018 APWA GSP) After the required amount of mineral materials, asphalt binder, recycling agent and anti-stripping additives have been introduced into the mixer the HMA shall be mixed until complete and uniform coating of the particles and thorough distribution of the asphalt binder throughout the mineral materials is ensured. When discharged, the temperature of the HMA shall not exceed the optimum mixing temperature by more than 25°F as shown on the reference mix design report or as approved by the Engineer. Also, when a WMA additive is included in the manufacture of HMA, the discharge temperature of the HMA shall not exceed the maximum recommended by the manufacturer of the WMA additive. A maximum water content of 2 percent in the mix, at discharge, will be allowed providing the water causes no problems with handling, stripping, or flushing. If the water in the HMA causes any of these problems, the moisture content shall be reduced as directed by the Engineer. Storing or holding of the HMA in approved storage facilities will be permitted with approval of the Engineer, but in no event shall the HMA be held for more than 24 hours. HMA held for more than 24 hours after mixing shall be rejected. Rejected HMA shall be disposed of by the Contractor at no expense to the Contracting Agency. The storage facility shall have an accessible device located at the top of the cone or about the third point. The device shall indicate the amount of material in storage. No HMA shall be accepted from the storage facility when the HMA in storage is below the top of the cone of the storage facility, except as the storage facility is being emptied at the end of the working shift. 212th St. Preservation/Holcomb SP - 83 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Recycled asphalt pavement (RAP) utilized in the production of HMA shall be sized prior to entering the mixer so that a uniform and thoroughly mixed HMA is produced. If there is evidence of the recycled asphalt pavement not breaking down during the heating and mixing of the HMA, the Contractor shall immediately suspend the use of the RAP until changes have been approved by the Engineer. After the required amount of mineral materials, RAP, new asphalt binder and asphalt rejuvenator have been introduced into the mixer the HMA shall be mixed until complete and uniform coating of the particles and thorough distribution of the asphalt binder throughout the mineral materials, and RAP is ensured. 5-04.3(7) Spreading and Finishing (Kent Special Provision) The mixture shall be laid upon an approved surface, spread, and struck off to the grade and elevation established. HMA pavers complying with Section 5-04.3(3) shall be used to distribute the mixture. Unless otherwise directed by the Engineer, the nominal compacted depth of any layer of any course shall not exceed the following: HMA Class 1” wearing course/final lift 0.17 feet other courses 0.35 feet HMA Class ¾” and HMA Class ½” wearing course/final lift 0.17 feet other courses 0.25 feet HMA Class ⅜” 0.17 feet On areas where irregularities or unavoidable obstacles make the use of mechanical spreading and finishing equipment impractical, the paving may be done with other equipment or by hand. When more than one JMF is being utilized to produce HMA, the material produced for each JMF shall be placed by separate spreading and compacting equipment. The intermingling of HMA produced from more than one JMF is prohibited. Each strip of HMA placed during a work shift shall conform to a single JMF established for the class of HMA specified unless there is a need to make an adjustment in the JMF. Reference Section 8-20.3(14)C of the Kent Special Provisions for the placement of traffic signal detection loops. 5-04.3(8) Aggregate Acceptance Prior to Incorporation in HMA (March 5, 2018 APWA GSP) For HMA accepted by nonstatistical evaluation the aggregate properties of sand equivalent, uncompacted void content and fracture will be evaluated in accordance with Section 3-04. Sampling and testing of aggregates for HMA accepted by commercial evaluation will be at the option of the Engineer. 212th St. Preservation/Holcomb SP - 84 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-04.3(9) HMA Mixture Acceptance (March 5, 2018 APWA GSP) Acceptance of HMA shall be as provided under nonstatistical, or commercial evaluation. Nonstatistical evaluation will be used for the acceptance of HMA unless Commercial Evaluation is specified. Commercial evaluation will be used for Commercial HMA and for other classes of HMA in the following applications: sidewalks, road approaches, ditches, slopes, paths, trails, gores, prelevel, temporary pavement, and pavement repair. Other nonstructural applications of HMA accepted by commercial evaluation shall be as approved by the Engineer. Sampling and testing of HMA accepted by commercial evaluation will be at the option of the Engineer. The mix design will be the initial JMF for the class of HMA. The Contractor may request a change in the JMF. Any adjustments to the JMF will require the approval of the Engineer and may be made in accordance with this section. HMA Tolerances and Adjustments 1. Job Mix Formula Tolerances – The constituents of the mixture at the time of acceptance shall conform to the following tolerances: Aggregate Percent Passing Non-Statistical Evaluation Commercial Evaluation 1”, ¾”, ½”, and 3/8” sieves +/- 6% +/- 8% No. 4 sieve +/-6% +/- 8% No. 8 Sieve +/- 6% +/-8% No. 200 sieve +/- 2.0% +/- 3.0% Asphalt Binder +/- 0.5% +/- 0.7% Air Voids, Va 2.5% min. and 5.5% max N/A These tolerance limits constitute the allowable limits as described in Section 1- 06.2. The tolerance limit for aggregate shall not exceed the limits of the control points, except the tolerance limits for sieves designated as 100 percent passing will be 99-100. 2. Job Mix Formula Adjustments – An adjustment to the aggregate gradation or asphalt binder content of the JMF requires approval of the Engineer. Adjustments to the JMF will only be considered if the change produces material of equal or better quality and may require the development of a new mix design if the adjustment exceeds the amounts listed below. a. Aggregates –2 percent for the aggregate passing the 1½″, 1″, ¾″, ½″, ⅜″, and the No. 4 sieves, 1 percent for aggregate passing the No. 8 sieve, and 0.5 percent for the aggregate passing the No. 200 sieve. The adjusted JMF shall be within the range of the control points in Section 9-03.8(6). b. Asphalt Binder Content – The Engineer may order or approve changes to asphalt binder content. The maximum adjustment from the approved mix design for the asphalt binder content shall be 0.3 percent 212th St. Preservation/Holcomb SP - 85 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (Kent Special Provision) For Asphalt Binder and Air Voids (Va), the acceptance limits are determined by adding the tolerances above to the approved JMF values. These values will also be the Upper Specification Limit (USL) and Lower Specification Limit (LSL) required in Section 1-06.2(2)D2. For Aggregates in the mixture: a. First, determine preliminary upper and lower acceptance limits by applying the following tolerances to the approved JMF. b. Second, adjust the preliminary upper and lower acceptance limits determined from step (a) the minimum amount necessary so that none of the aggregate properties are outside the control points in Section 9-03.8(6). The resulting values will be the upper and lower acceptance limits for aggregates, as well as the USL and LSL required in Section 1-06.2(2)D2. 5-04.3(9)A Vacant 5-04.3(9)B Vacant 5-04.3(9)C Mixture Acceptance – Nonstatistical Evaluation HMA mixture which is accepted by Nonstatistical Evaluation will be evaluated by the Contracting Agency by dividing the HMA tonnage into lots. 5-04.3(9)C1 Mixture Nonstatistical Evaluation – Lots and Sublots A lot is represented by randomly selected samples of the same mix design that will be tested for acceptance. A lot is defined as the total quantity of material or work produced for each Job Mix Formula placed. Only one lot per JMF is expected. A sublot shall be equal to one day’s production or 800 tons, whichever is less except that the final sublot will be a minimum of 400 tons and may be increased to 1200 tons. All of the test results obtained from the acceptance samples from a given lot shall be evaluated collectively. If the Contractor requests a change to the JMF that is approved, the material produced after the change will be evaluated on the basis of the new JMF for the remaining sublots in the current lot and for acceptance of subsequent lots. For a lot in progress with a CPF less than 0.75, a new lot will begin at the Contractor’s request after the Engineer is satisfied that material conforming to the Specifications can be produced. Sampling and testing for evaluation shall be performed on the frequency of one sample per sublot. 5-04.3(9)C2 Mixture Nonstatistical Evaluation Sampling Samples for acceptance testing shall be obtained by the Contractor when ordered by the Engineer. The Contractor shall sample the HMA mixture in the presence of the Engineer and in accordance with AASHTO T 168. A minimum of three samples 212th St. Preservation/Holcomb SP - 86 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 should be taken for each class of HMA placed on a project. If used in a structural application, at least one of the three samples shall to be tested. Sampling and testing HMA in a Structural application where quantities are less than 400 tons is at the discretion of the Engineer. For HMA used in a structural application and with a total project quantity less than 800 tons but more than 400 tons, a minimum of one acceptance test shall be performed. In all cases, a minimum of 3 samples will be obtained at the point of acceptance, a minimum of one of the three samples will be tested for conformance to the JMF: • If the test results are found to be within specification requirements, additional testing will be at the Engineer’s discretion. • If test results are found not to be within specification requirements, additional testing of the remaining samples to determine a Composite Pay Factor (CPF) shall be performed. 5-04.3(9)C3 Mixture Nonstatistical Evaluation – Acceptance Testing Testing of HMA for compliance of Va will be at the option of the Contracting Agency. If tested, compliance of Va will use WSDOT SOP 731. Testing for compliance of asphalt binder content will be by WSDOT FOP for AASHTO T 308. Testing for compliance of gradation will be by FOP for WAQTC T 27/T 11. 5-04.3(9)C4 Mixture Nonstatistical Evaluation – Pay Factors For each lot of material falling outside the tolerance limits in 5-04.3(9), the Contracting Agency will determine a Composite Pay Factor (CPF) using the following price adjustment factors: Table of Price Adjustment Factors Constituent Factor “f” All aggregate passing: 1½″, 1″, ¾″, ½″, ⅜″ and No.4 sieves 2 All aggregate passing No. 8 sieve 15 All aggregate passing No. 200 sieve 20 Asphalt binder 40 Air Voids (Va) (where applicable) 20 Each lot of HMA produced under Nonstatistical Evaluation and having all constituents falling within the tolerance limits of the job mix formula shall be accepted at the unit Contract price with no further evaluation. When one or more constituents fall outside the nonstatistical tolerance limits in the Job Mix Formula shown in Table of Price Adjustment Factors, the lot shall be evaluated in accordance with Section 1-06.2 to determine the appropriate CPF. The 212th St. Preservation/Holcomb SP - 87 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 nonstatistical tolerance limits will be used in the calculation of the CPF and the maximum CPF shall be 1.00. When less than three sublots exist, backup samples of the existing sublots or samples from the Roadway shall be tested to provide a minimum of three sets of results for evaluation. 5-04.3(9)C5 Vacant 5-04.3(9)C6 Mixture Nonstatistical Evaluation – Price Adjustments For each lot of HMA mix produced under Nonstatistical Evaluation when the calculated CPF is less than 1.00, a Nonconforming Mix Factor (NCMF) will be determined. The NCMF equals the algebraic difference of CPF minus 1.00 multiplied by 60 percent. The total job mix compliance price adjustment will be calculated as the product of the NCMF, the quantity of HMA in the lot in tons, and the unit Contract price per ton of mix. If a constituent is not measured in accordance with these Specifications, its individual pay factor will be considered 1.00 in calculating the Composite Pay Factor (CPF). 5-04.3(9)C7 Mixture Nonstatistical Evaluation - Retests The Contractor may request a sublot be retested. To request a retest, the Contractor shall submit a written request within 7 calendar days after the specific test results have been received. A split of the original acceptance sample will be retested. The split of the sample will not be tested with the same tester that ran the original acceptance test. The sample will be tested for a complete gradation analysis, asphalt binder content, and, at the option of the agency, Va. The results of the retest will be used for the acceptance of the HMA in place of the original sublot sample test results. The cost of testing will be deducted from any monies due or that may come due the Contractor under the Contract at the rate of $500 per sample. 5-04.3 (9)D Mixture Acceptance – Commercial Evaluation If sampled and tested, HMA produced under Commercial Evaluation and having all constituents falling within the tolerance limits of the job mix formula shall be accepted at the unit Contract price with no further evaluation. When one or more constituents fall outside the commercial tolerance limits in the Job Mix Formula shown in 5-04.3(9), the lot shall be evaluated in accordance with Section 1-06.2 to determine the appropriate CPF. The commercial tolerance limits will be used in the calculation of the CPF and the maximum CPF shall be 1.00. When less than three sublots exist, backup samples of the existing sublots or samples from the street shall be tested to provide a minimum of three sets of results for evaluation. For each lot of HMA mix produced and tested under Commercial Evaluation when the calculated CPF is less than 1.00, a Nonconforming Mix Factor (NCMF) will be determined. The NCMF equals the algebraic difference of CPF minus 1.00 multiplied by 60 percent. The Job Mix Compliance Price Adjustment will be calculated as the product of the NCMF, the quantity of HMA in the lot in tons, and the unit Contract price per ton of mix. 212th St. Preservation/Holcomb SP - 88 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 If a constituent is not measured in accordance with these Specifications, its individual pay factor will be considered 1.00 in calculating the Composite Pay Factor (CPF). 5-04.3(10) HMA Compaction Acceptance (March 5, 2018 APWA GSP) HMA mixture accepted by nonstatistical evaluation that is used in traffic lanes, including lanes for intersections, ramps, truck climbing, weaving, and speed change, and having a specified compacted course thickness greater than 0.10-foot, shall be compacted to a specified level of relative density. The specified level of relative density shall be a Composite Pay Factor (CPF) of not less than 0.75 when evaluated in accordance with Section 1-06.2, using a LSL of 92.0 (minimum of 92 percent of the maximum density). The maximum density shall be determined by WSDOT FOP for AASHTO T 729. The specified level of density attained will be determined by the evaluation of the density of the pavement. The density of the pavement shall be determined in accordance with WSDOT FOP for WAQTC TM 8, except that gauge correlation will be at the discretion of the Engineer, when using the nuclear density gauge and WSDOT SOP 736 when using cores to determine density. Tests for the determination of the pavement density will be taken in accordance with the required procedures for measurement by a nuclear density gauge or roadway cores after completion of the finish rolling. If the Contracting Agency uses a nuclear density gauge to determine density the test procedures FOP for WAQTC TM 8 and WSDOT SOP T 729 will be used on the day the mix is placed and prior to opening to traffic. Roadway cores for density may be obtained by either the Contracting Agency or the Contractor in accordance with WSDOT SOP 734. The core diameter shall be 4- inches minimum, unless otherwise approved by the Engineer. Roadway cores will be tested by the Contracting Agency in accordance with WSDOT FOP for AASHTO T 166. If the Contract includes the Bid item “Roadway Core” the cores shall be obtained by the Contractor in the presence of the Engineer on the same day the mix is placed and at locations designated by the Engineer. If the Contract does not include the Bid item “Roadway Core” the Contracting Agency may obtain the cores. For a lot in progress with a CPF less than 0.75, a new lot will begin at the Contractor’s request after the Engineer is satisfied that material conforming to the Specifications can be produced. HMA mixture accepted by commercial evaluation and HMA constructed under conditions other than those listed above shall be compacted on the basis of a test point evaluation of the compaction train. The test point evaluation shall be performed in accordance with instructions from the Engineer. The number of passes with an approved compaction train, required to attain the maximum test point density, shall be used on all subsequent paving. 212th St. Preservation/Holcomb SP - 89 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 HMA for preleveling shall be thoroughly compacted. HMA that is used for preleveling wheel rutting shall be compacted with a pneumatic tire roller unless otherwise approved by the Engineer. Test Results For a sublot that has been tested with a nuclear density gauge that did not meet the minimum of 92 percent of the reference maximum density in a compaction lot with a CPF below 1.00 and thus subject to a price reduction or rejection, the Contractor may request that a core be used for determination of the relative density of the sublot. The relative density of the core will replace the relative density determined by the nuclear density gauge for the sublot and will be used for calculation of the CPF and acceptance of HMA compaction lot. When cores are taken by the Contracting Agency at the request of the Contractor, they shall be requested by noon of the next workday after the test results for the sublot have been provided or made available to the Contractor. Core locations shall be outside of wheel paths and as determined by the Engineer. Traffic control shall be provided by the Contractor as requested by the Engineer. Failure by the Contractor to provide the requested traffic control will result in forfeiture of the request for cores. When the CPF for the lot based on the results of the HMA cores is less than 1.00, the cost for the coring will be deducted from any monies due or that may become due the Contractor under the Contract at the rate of $200 per core and the Contractor shall pay for the cost of the traffic control. 5-04.3(10)A HMA Compaction – General Compaction Requirements Compaction shall take place when the mixture is in the proper condition so that no undue displacement, cracking, or shoving occurs. Areas inaccessible to large compaction equipment shall be compacted by other mechanical means. Any HMA that becomes loose, broken, contaminated, shows an excess or deficiency of asphalt, or is in any way defective, shall be removed and replaced with new hot mix that shall be immediately compacted to conform to the surrounding area. The type of rollers to be used and their relative position in the compaction sequence shall generally be the Contractor’s option, provided the specified densities are attained. Unless the Engineer has approved otherwise, rollers shall only be operated in the static mode when the internal temperature of the mix is less than 175°F. Regardless of mix temperature, a roller shall not be operated in a mode that results in checking or cracking of the mat. Rollers shall only be operated in static mode on bridge decks. 5-04.3(10)B HMA Compaction – Cyclic Density Low cyclic density areas are defined as spots or streaks in the pavement that are less than 90 percent of the theoretical maximum density. At the Engineer’s discretion, the Engineer may evaluate the HMA pavement for low cyclic density, and when doing so will follow WSDOT SOP 733. A $500 Cyclic Density Price Adjustment will be assessed for any 500-foot section with two or more density readings below 90 percent of the theoretical maximum density. 5-04.3(10)C Vacant 212th St. Preservation/Holcomb SP - 90 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-04.3(10)D HMA Nonstatistical Compaction 5-04.3(10)D1 HMA Nonstatistical Compaction – Lots and Sublots HMA compaction which is accepted by nonstatistical evaluation will be based on acceptance testing performed by the Contracting Agency dividing the project into compaction lots. A lot is represented by randomly selected samples of the same mix design that will be tested for acceptance. A lot is represented by randomly selected samples of the same mix design that will be tested for acceptance. A lot is defined as the total quantity of material or work produced for each Job Mix Formula placed. Only one lot per JMF is expected. A sublot shall be equal to one day’s production or 400 tons, whichever is less except that the final sublot will be a minimum of 200 tons and may be increased to 800 tons. Testing for compaction will be at the rate of 5 tests per sublot per WSDOT T 738. HMA mixture accepted by commercial evaluation and HMA constructed under conditions other than those listed above shall be compacted on the basis of a test point evaluation of the compaction train. The test point evaluation shall be performed in accordance with instructions from the Engineer. The number of passes with an approved compaction train, required to attain the maximum test point density, shall be used on all subsequent paving. HMA for preleveling shall be thoroughly compacted. HMA that is used to prelevel wheel ruts shall be compacted with a pneumatic tire roller unless otherwise approved by the Engineer. 5-04.3(10)D2 HMA Compaction Nonstatistical Evaluation – Acceptance Testing The location of the HMA compaction acceptance tests will be randomly selected by the Engineer from within each sublot, with one test per sublot. 5-04.3(10)D3 HMA Nonstatistical Compaction – Price Adjustments For each compaction lot with one or two sublots, having all sublots attain a relative density that is 92 percent of the reference maximum density the HMA shall be accepted at the unit Contract price with no further evaluation. When a sublot does not attain a relative density that is 92 percent of the reference maximum density, the lot shall be evaluated in accordance with Section 1-06.2 to determine the appropriate CPF. The maximum CPF shall be 1.00, however, lots with a calculated CPF in excess of 1.00 will be used to offset lots with CPF values below 1.00 but greater than 0.90. Lots with CPF lower than 0.90 will be evaluated for compliance per 5-04.3(11). Additional testing by either a nuclear moisture-density gauge or cores will be completed as required to provide a minimum of three tests for evaluation. For compaction below the required 92% a Non-Conforming Compaction Factor (NCCF) will be determined. The NCCF equals the algebraic difference of CPF minus 1.00 multiplied by 40 percent. The Compaction Price Adjustment will be calculated as the product of CPF, the quantity of HMA in the compaction control lot in tons, 212th St. Preservation/Holcomb SP - 91 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 and the unit Contract price per ton of mix. 5-04.3(11) Reject Work (March 5, 2018 APWA GSP) 5-04.3(11)A Reject Work General Work that is defective or does not conform to Contract requirements shall be rejected. The Contractor may propose, in writing, alternatives to removal and replacement of rejected material. Acceptability of such alternative proposals will be determined at the sole discretion of the Engineer. HMA that has been rejected is subject to the requirements in Section 1-06.2(2) and this specification, and the Contractor shall submit a corrective action proposal to the Engineer for approval. 5-04.3(11)B Rejection by Contractor The Contractor may, prior to sampling, elect to remove any defective material and replace it with new material. Any such new material will be sampled, tested, and evaluated for acceptance. 5-04.3(11)C Rejection Without Testing (Mixture or Compaction) The Engineer may, without sampling, reject any batch, load, or section of Roadway that appears defective. Material rejected before placement shall not be incorporated into the pavement. Any rejected section of Roadway shall be removed. No payment will be made for the rejected materials or the removal of the materials unless the Contractor requests that the rejected material be tested. If the Contractor elects to have the rejected material tested, a minimum of three representative samples will be obtained and tested. Acceptance of rejected material will be based on conformance with the nonstatistical acceptance Specification. If the CPF for the rejected material is less than 0.75, no payment will be made for the rejected material; in addition, the cost of sampling and testing shall be borne by the Contractor. If the CPF is greater than or equal to 0.75, the cost of sampling and testing will be borne by the Contracting Agency. If the material is rejected before placement and the CPF is greater than or equal to 0.75, compensation for the rejected material will be at a CPF of 0.75. If rejection occurs after placement and the CPF is greater than or equal to 0.75, compensation for the rejected material will be at the calculated CPF with an addition of 25 percent of the unit Contract price added for the cost of removal and disposal. 5-04.3(11)D Rejection - A Partial Sublot In addition to the random acceptance sampling and testing, the Engineer may also isolate from a normal sublot any material that is suspected of being defective in relative density, gradation or asphalt binder content. Such isolated material will not include an original sample location. A minimum of three random samples of the suspect material will be obtained and tested. The material will then be statistically evaluated as an independent lot in accordance with Section 1-06.2(2). 212th St. Preservation/Holcomb SP - 92 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-04.3(11)E Rejection - An Entire Sublot An entire sublot that is suspected of being defective may be rejected. When a sublot is rejected a minimum of two additional random samples from this sublot will be obtained. These additional samples and the original sublot will be evaluated as an independent lot in accordance with Section 1-06.2(2). 5-04.3(11)F Rejection - A Lot in Progress The Contractor shall shut down operations and shall not resume HMA placement until such time as the Engineer is satisfied that material conforming to the Specifications can be produced: 1. When the Composite Pay Factor (CPF) of a lot in progress drops below 1.00 and the Contractor is taking no corrective action, or 2. When the Pay Factor (PF) for any constituent of a lot in progress drops below 0.95 and the Contractor is taking no corrective action, or 3. When either the PFi for any constituent or the CPF of a lot in progress is less than 0.75. 5-04.3(11)G Rejection - An Entire Lot (Mixture or Compaction) An entire lot with a CPF of less than 0.75 will be rejected. 5-04.3(12) Joints (March 5, 2018 APWA GSP) 5-04.3(12)A HMA Joints 5-04.3(12)A1 Transverse Joints The Contractor shall conduct operations such that the placing of the top or wearing course in a continuous operation or as close to continuous as possible. Unscheduled transverse joints will be allowed and the roller may pass over the unprotected end of the freshly laid mixture only when the placement of the course must be discontinued for such a length of time that the mixture will cool below compaction temperature. When the Work is resumed, the previously compacted mixture shall be cut back to produce a slightly beveled edge for the full thickness of the course. A temporary wedge of HMA constructed on a 20H:1V shall be constructed where a transverse joint as a result of paving or planing is open to traffic. The HMA in the temporary wedge shall be separated from the permanent HMA by strips of heavy wrapping paper or other methods approved by the Engineer. The wrapping paper shall be removed and the joint trimmed to a slightly beveled edge for the full thickness of the course prior to resumption of paving. The material that is cut away shall be wasted and new mix shall be laid against the cut. Rollers or tamping irons shall be used to seal the joint. 212th St. Preservation/Holcomb SP - 93 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-04.3(12)A2 Longitudinal Joints The longitudinal joint in any one course shall be offset from the course immediately below by not more than 6 inches nor less than 2 inches. All longitudinal joints constructed in the wearing course shall be located at a lane line or an edge line of the Traveled Way. A notched wedge joint shall be constructed along all longitudinal joints in the wearing surface of new HMA unless otherwise approved by the Engineer. The notched wedge joint shall have a vertical edge of not less than the maximum aggregate size or more than ½ of the compacted lift thickness and then taper down on a slope not steeper than 4H:1V. The sloped portion of the HMA notched wedge joint shall be uniformly compacted. 5-04.3(12)B Bridge Paving Joint Seals 5-04.3(12)B1 HMA Sawcut and Seal Prior to placing HMA on the bridge deck, establish sawcut alignment points at both ends of the bridge paving joint seals to be placed at the bridge ends, and at interior joints within the bridge deck when and where shown in the Plans. Establish the sawcut alignment points in a manner that they remain functional for use in aligning the sawcut after placing the overlay. Submit a Type 1 Working Drawing consisting of the sealant manufacturer’s application procedure. Construct the bridge paving joint seal as specified ion the Plans and in accordance with the detail shown in the Standard Plans. Construct the sawcut in accordance with the detail shown in the Standard Plan. Construct the sawcut in accordance with Section 5-05.3(8)B and the manufacturer’s application procedure. 5-04.3(12)B2 Paved Panel Joint Seal Construct the paved panel joint seal in accordance with the requirements specified in section 5-04.3(12)B1 and the following requirement: 1. Clean and seal the existing joint between concrete panels in accordance with Section 5-01.3(8) and the details shown in the Standard Plans. 5-04.3(13) Surface Smoothness (March 5, 2018 APWA GSP) The completed surface of all courses shall be of uniform texture, smooth, uniform as to crown and grade, and free from defects of all kinds. The completed surface of the wearing course shall not vary more than ⅛ inch from the lower edge of a 10- foot straightedge placed on the surface parallel to the centerline. The transverse slope of the completed surface of the wearing course shall vary not more than ¼ inch in 10 feet from the rate of transverse slope shown in the Plans. When deviations in excess of the above tolerances are found that result from a high place in the HMA, the pavement surface shall be corrected by one of the following methods: 1. Removal of material from high places by grinding with an approved grinding 212th St. Preservation/Holcomb SP - 94 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 machine, or 2. Removal and replacement of the wearing course of HMA, or 3. By other method approved by the Engineer. Correction of defects shall be carried out until there are no deviations anywhere greater than the allowable tolerances. Deviations in excess of the above tolerances that result from a low place in the HMA and deviations resulting from a high place where corrective action, in the opinion of the Engineer, will not produce satisfactory results will be accepted with a price adjustment. The Engineer shall deduct from monies due or that may become due to the Contractor the sum of $500.00 for each and every section of single traffic lane 100 feet in length in which any excessive deviations described above are found. When utility appurtenances such as manhole covers and valve boxes are located in the traveled way, the utility appurtenances shall be adjusted to the finished grade prior to paving. This requirement may be waived when requested by the Contractor, at the discretion of the Engineer or when the adjustment details provided in the project plan or specifications call for utility appurtenance adjustments after the completion of paving. Utility appurtenance adjustment discussions will be included in the Pre-Paving planning (5-04.3(14)B3). Submit a written request to waive this requirement to the Engineer prior to the start of paving. 5-04.3(14) Planing (Milling) Bituminous Pavement (March 5, 2018 APWA GSP) The planing plan must be approved by the Engineer and a pre planing meeting must be held prior to the start of any planing. See Section 5-04.3(14)B2 for information on planing submittals. Locations of existing surfacing to be planed are as shown in the Drawings. Where planing an existing pavement is specified in the Contract, the Contractor must remove existing surfacing material and to reshape the surface to remove irregularities. The finished product must be a prepared surface acceptable for receiving an HMA overlay. Use the cold milling method for planing unless otherwise specified in the Contract. Do not use the planer on the final wearing course of new HMA. Conduct planing operations in a manner that does not tear, break, burn, or otherwise damage the surface which is to remain. The finished planed surface must be slightly grooved or roughened and must be free from gouges, deep grooves, ridges, or other imperfections. The Contractor must repair any damage to the surface by the Contractor’s planing equipment, using an Engineer approved method. Repair or replace any metal castings and other surface improvements damaged by planing, as determined by the Engineer. 212th St. Preservation/Holcomb SP - 95 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 A tapered wedge cut must be planed longitudinally along curb lines sufficient to provide a minimum of 4 inches of curb reveal after placement and compaction of the final wearing course. The dimensions of the wedge must be as shown on the Drawings or as specified by the Engineer. A tapered wedge cut must also be made at transitions to adjoining pavement surfaces (meet lines) where butt joints are shown on the Drawings. Cut butt joints in a straight line with vertical faces 2 inches or more in height, producing a smooth transition to the existing adjoining pavement. After planing is complete, planed surfaces must be swept, cleaned, and if required by the Contract, patched and preleveled. The Engineer may direct additional depth planing. Before performing this additional depth planing, the Contractor must conduct a hidden metal in pavement detection survey as specified in Section 5-04.3(14)A. (******) At the 77th Ave S and 212th Street intersection the existing concrete traffic curbing shall be protected and may not be removed. Planing may taper on either side to allow existing curbing to remain. Planing operations shall be performed no more than 7 calendar days ahead of the time the planed area is to be paved, unless otherwise allowed by the Engineer in writing. 5-04.3(14)A Pre-Planing Metal Detection Check Before starting planing of pavements, and before any additional depth planing required by the Engineer, the Contractor must conduct a physical survey of existing pavement to be planed with equipment that can identify hidden metal objects. Should such metal be identified, promptly notify the Engineer. See Section 1-07.16(1) regarding the protection of survey monumentation that may be hidden in pavement. The Contractor is solely responsible for any damage to equipment resulting from the Contractor’s failure to conduct a pre-planing metal detection survey, or from the Contractor’s failure to notify the Engineer of any hidden metal that is detected. 5-04.3(14)B Paving And Planing Under Traffic 5-04.3(14)B1 General In addition the requirements of Section 1-07.23 and the traffic controls required in Section 1-10, and unless the Contract specifies otherwise or the Engineer approves, the Contractor must comply with the following: 1. Intersections: 212th St. Preservation/Holcomb SP - 96 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 a. Keep intersections open to traffic at all times, except when paving or planing operations through an intersection requires closure. Such closure must be kept to the minimum time required to place and compact the HMA mixture, or plane as appropriate. For paving, schedule such closure to individual lanes or portions thereof that allows the traffic volumes and schedule of traffic volumes required in the approved traffic control plan. Schedule work so that adjacent intersections are not impacted at the same time and comply with the traffic control restrictions required by the Traffic Engineer. Each individual intersection closure or partial closure, must be addressed in the traffic control plan, which must be submitted to and accepted by the Engineer, see Section 1-10.2(2). b. When planing or paving and related construction must occur in an intersection, consider scheduling and sequencing such work into quarters of the intersection, or half or more of an intersection with side street detours. Be prepared to sequence the work to individual lanes or portions thereof. c. Should closure of the intersection in its entirety be necessary, and no trolley service is impacted, keep such closure to the minimum time required to place and compact the HMA mixture, plane, remove asphalt, tack coat, and as needed. d. Any work in an intersection requires advance warning in both signage and a number of Working Days advance notice as determined by the Engineer, to alert traffic and emergency services of the intersection closure or partial closure. e. Allow new compacted HMA asphalt to cool to ambient temperature before any traffic is allowed on it. Traffic is not allowed on newly placed asphalt until approval has been obtained from the Engineer. 2. Temporary centerline marking, post-paving temporary marking, temporary stop bars, and maintaining temporary pavement marking must comply with Section 8-23. 3. Permanent pavement marking must comply with Section 8-22. 5-04.3(14)B2 Submittals - Planing Plan And HMA Paving Plan The Contractor must submit a separate planing plan and a separate paving plan to the Engineer at least 5 Working Days in advance of each operation’s activity start date. These plans must show how the moving operation and traffic control are coordinated, as they will be discussed at the pre-planing briefing and pre- paving briefing. When requested by the Engineer, the Contractor must provide each operation’s traffic control plan on 24 x 36 inch or larger size Shop Drawings with a scale showing both the area of operation and sufficient detail of traffic beyond the area of operation where detour traffic may be required. The scale on the Shop Drawings is 1 inch = 20 feet, which may be changed if the Engineer agrees sufficient detail is shown. The planing operation and the paving operation include, but are not limited to, metal detection, removal of asphalt and temporary asphalt of any kind, tack coat and drying, staging of supply trucks, paving trains, rolling, scheduling, and as may be discussed at the briefing. 212th St. Preservation/Holcomb SP - 97 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 When intersections will be partially or totally blocked, provide adequately sized and noticeable signage alerting traffic of closures to come, a minimum 2 Working Days in advance. The traffic control plan must show where peace officers will be stationed when signalization is or may be, countermanded, and show areas where flaggers are proposed. At a minimum, the planing and the paving plan must include: 1. A copy of the accepted traffic control plan, see Section 1-10.2(2), detailing each day’s traffic control as it relates to the specific requirements of that day’s planing and paving. Briefly describe the sequencing of traffic control consistent with the proposed planing and paving sequence, and scheduling of placement of temporary pavement markings and channelizing devices after each day’s planing, and paving. 2. A copy of each intersection’s traffic control plan. 3. Haul routes from Supplier facilities, and locations of temporary parking and staging areas, including return routes. Describe the complete round trip as it relates to the sequencing of paving operations. 4. Names and locations of HMA Supplier facilities to be used. 5. List of all equipment to be used for paving. 6. List of personnel and associated job classification assigned to each piece of paving equipment. 7. Description (geometric or narrative) of the scheduled sequence of planing and of paving, and intended area of planing and of paving for each day’s work, must include the directions of proposed planing and of proposed paving, sequence of adjacent lane paving, sequence of skipped lane paving, intersection planing and paving scheduling and sequencing, and proposed notifications and coordinations to be timely made. The plan must show HMA joints relative to the final pavement marking lane lines. 8. Names, job titles, and contact information for field, office, and plant supervisory personnel. 9. A copy of the approved Mix Designs. 10. Tonnage of HMA to be placed each day. 11. Approximate times and days for starting and ending daily operations. 5-04.3(14)B3 Pre-Paving And Pre-Planing Briefing At least 2 Working Days before the first paving operation and the first planing operation, or as scheduled by the Engineer for future paving and planing operations to ensure the Contractor has adequately prepared for notifying and coordinating as required in the Contract, the Contractor must be prepared to discuss that day’s operations as they relate to other entities and to public safety and convenience, including driveway and business access, garbage truck operations, Metro transit operations and working around energized overhead wires, school and nursing home and hospital and other accesses, other contractors who may be operating in the area, pedestrian and bicycle traffic, and emergency services. The Contractor, and Subcontractors that may be part of that day’s operations, must meet with the Engineer and discuss the proposed operation as it relates to the submitted planing plan and paving plan, approved traffic control plan, and public convenience and safety. Such discussion includes, but is not limited to: 212th St. Preservation/Holcomb SP - 98 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 1. General for both Paving Plan and for Planing Plan: a. The actual times of starting and ending daily operations. b. In intersections, how to break up the intersection, and address traffic control and signalization for that operation, including use of peace officers. c. The sequencing and scheduling of paving operations and of planing operations, as applicable, as it relates to traffic control, to public convenience and safety, and to other contractors who may operate in the Project Site. d. Notifications required of Contractor activities, and coordinating with other entities and the public as necessary. e. Description of the sequencing of installation and types of temporary pavement markings as it relates to planing and to paving. f. Description of the sequencing of installation of, and the removal of, temporary pavement patch material around exposed castings and as may be needed. g. Description of procedures and equipment to identify hidden metal in the pavement, such as survey monumentation, monitoring wells, street car rail, and castings, before planing, see Section 5-04.3(14)B2. h. Description of how flaggers will be coordinated with the planing, paving, and related operations. i. Description of sequencing of traffic controls for the process of rigid pavement base repairs. j. Other items the Engineer deems necessary to address. 2. Paving – additional topics: a. When to start applying tack and coordinating with paving. b. Types of equipment and numbers of each type of equipment to be used. If more pieces of equipment than personnel are proposed, describe the sequencing of the personnel operating the types of equipment. Discuss the continuance of operator personnel for each type of equipment as it relates to meeting Specification requirements. c. Number of JMFs to be placed, and if more than one JMF how the Contractor will ensure different JMFs are distinguished, how pavers and MTVs are distinguished if more than one JMF is being placed at the time, and how pavers and MTVs are cleaned so that one JMF does not adversely influence the other JMF. d. Description of contingency plans for that day’s operations such as equipment breakdown, rain out, and Supplier shutdown of operations. e. Number of sublots to be placed, sequencing of density testing, and other sampling and testing. 5-04.3(15) Sealing Pavement Surfaces (March 5, 2018 APWA GSP) Apply a fog seal where shown in the plans. Construct the fog seal in accordance with Section 5-02.3. Unless otherwise approved by the Engineer, apply the fog seal prior to opening to traffic. 5-04.3(16) HMA Road Approaches (March 5, 2018 APWA GSP) 212th St. Preservation/Holcomb SP - 99 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 HMA approaches shall be constructed at the locations shown in the Plans or where staked by the Engineer. The Work shall be performed in accordance with Section 5- 04. (******) 5-04.4 Measurement (Kent Special Provision) HMA Cl.1/2” PG 58V-22 will be measured by the ton in accordance with Section 1- 09.2, with no deduction being made for the weight of asphalt binder, mineral filler, or any other component of the mixture. If the Contractor elects to remove and replace mix as allowed by Section 5-04.3(11), the material removed will not be measured. Roadway cores will be measured per each for the number of cores taken. Preparation of untreated roadway will be measured by the mile once along the centerline of the main line Roadway. No additional measurement will be made for ramps, Auxiliary Lanes, service roads, Frontage Roads, or Shoulders. Measurement will be to the nearest 0.01 mile. Soil residual herbicide will be measured by the mile for the stated width to the nearest 0.01 mile or by the square yard, whichever is designated in the Proposal. Pavement repair excavation will be measured by the square yard of surface marked prior to excavation. Asphalt for prime coat will be measured by the ton in accordance with Section 1- 09.2. Prime coat aggregate will be measured by the cubic yard, truck measure, or by the ton, whichever is designated in the Proposal. Asphalt for fog seal will be measured by the ton, as provided in Section 5-02.4. Longitudinal joint seals between the HMA and cement concrete pavement will be measured by the linear foot along the line and slope of the completed joint seal. Planing bituminous pavement will be measured by the square yard. Measurement shall be made upon actual square yards planed/grind, regardless of the full planing capacity of the equipment used. Planing Bituminous Pavement, 2 Inch Thick shall include all the entire overlay area. Additional Planing Bituminous Pavement, 2 Inch Thick shall include all areas where the engineer identified the need for an additional two inches of grind and inlay (resulting in a total planing depth of four inches). No measurement will be made for the installation, maintenance, and removal of temporary pavement markings. 212th St. Preservation/Holcomb SP - 100 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (******) 5-04.5 Payment (Kent Special Provision) Payment will be made for each of the following Bid items that are included in the Proposal: “HMA Class 1/2”, PG 58V-22” “HMA Class 1/2” for Full Width Overlay, PG 58V-22” The unit Contract price per ton for the above items shall be full compensation for all costs, including anti-stripping additive, incurred to carry out the requirements of Section 5-04 except for those costs included in other items which are included in this Subsection and which are included in the Proposal. This work shall include the cost to install an asphalt thickened edge and/or the pre-leveling work in the areas identified on the plans. The cost for water shall be included in this bid item. HMA Class 1/2” for Full Width Overlay, PG 58V-22 shall be used to pay for the two inches (0.17 feet) of wearing course/final lift of the overlay, all other HMA shall be paid for under HMA Class 1/2”, PG 58V-22. The unit contract price per ton for “Hot Plant Mix for Temporary Pavement Patch” shall be full pay for all costs of material, labor, tools, supplies and equipment necessary for furnishing, installing, maintaining, removing and disposing of hot plant mix as required to provide temporary roadway patching of pavement at the locations as specified herein and as directed by the Engineer. “Planing Bituminous Pavement, 2 Inch Thick” “Additional Planing Bituminous Pavement, 2 Inch Thick” The unit contract price per square yard for the above items shall be full payment for all costs incurred to perform the Work described in Section 5-04.3(14). This includes but is not limited to complete compensation for all materials, tools, equipment and labor necessary or incidental to plane/grind the thickness specified on the plans, clean, sweep, haul, stockpile or dispose of the asphalt concrete pavement as specified on the plans or as directed by the Engineer. No additional cost compensation shall be made for cold mix material to provide a temporary transition from planed areas to existing pavement. The areas of planing shown on the plans may be modified by the Engineer based on the condition of the existing pavement. The lump sum unit contract price for “Work within UPRR Right of Way” shall be full compensation for all work shown in the plans and described in the specification within thirty (30) feet of any UPRR track. This includes but is not limited to: meeting all UPRR safety requirements of the UPRR Right of Entry Agreement found in Appendix A-5; removal and disposal of HMA pavement, concrete curb and gutter and concrete sidewalk; sawcutting; 4” depth planning; 4” depth HMA Class 1/2”, PG 58V-22 paving; temporary pavement patching; cement concrete sidewalk; cement concrete ramp type single direction A; non-skid Type 1 Junction box; and all channelization shown on the plans. This body of work described in this bid item shall be completed in ten (10) working days per Section 1-07.18 of these specifications. This bid item shall not include flagging services for the UPRR tracks which will be provided by RailPros and paid for by the City. Any additional working days will be subject to liquidated damages described in Section 212th St. Preservation/Holcomb SP - 101 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 1-08.9 which include payment of all flagging expenses excluded the ten (10) days described above. City will pay UPRR administrative fees to complete the Right of Entry Agreement. Temporary traffic control shall be paid for under the appropriate bid items and shall not be included in the lump sum cost for this item. The lump sum unit contract price for “Work within BNSF Right of Way” shall be full compensation for all work shown in the plans and described in the specification within thirty (30) feet of any BNSF track. This includes but is not limited to: meeting all BNSF safety requirements of the BNSF Roadway Surfacing Agreement found in Appendix A-6; removal and disposal of HMA pavement, concrete curb and gutter and concrete sidewalk; sawcutting; 4” depth planning; 4” depth HMA Class 1/2”, PG 58V-22 paving; temporary pavement patching; cement concrete sidewalk; cement concrete ramp type single direction A; non-skid Type 1 Junction box; and all channelization shown on the plans. This body of work described in this bid item shall be completed in ten (10) working days per Section 1-07.18 of these specifications. This bid item shall not include payment of BNSF flagging services which will be paid for by the contractor and reimbursed under the “BNSF Railroad Flagging” bid item. Any additional working days will be subject to liquidated damages described in Section 1-08.9 which include payment of all flagging expenses excluded the ten (10) days described above. The City will pay BNSF administrative fees to complete the Roadway Surfacing Agreement. Temporary traffic control shall be paid for under the appropriate bid items and shall not be included in the lump sum cost for this bid item. The unit contract price per force account for “BNSF Railroad Flagging” constitutes complete compensation for reimbursement of BNSF Railroad Flagging expenses as described in the Roadway Surfacing Agreement. Per the Roadway Surfacing Agreement flagging cost shall be paid to BNSF by the contractor. This bid item will include up to 10 working days of BNSF railroad flagging. Any additional working days will be subject to liquidated damages described in Section 1-08.9 which include payment of all flagging expenses excluded the ten (10) days described above. The lump sum unit contract price for “Grind Around Manhole” shall be full compensation for all costs incurred to grind around the existing PSE manhole vault lid identified on the plans. This manhole cannot be lowered and is hot and shall not be disturbed. The contractor shall grind around it without disturbing the manhole and shall coordinate with PSE and the Engineer after the final lift has been paved to allow PSE and their crew to cut the asphalt around the manhole, adjust to grade, and pave. PSE will be responsible for all costs including traffic control to adjust this manhole. (January 2, 2018) Asphalt Cost Price Adjustment The Contracting Agency will make an Asphalt Cost Price Adjustment, either a credit or a payment, for qualifying changes in the reference cost of asphalt binder. The adjustment will be applied to partial payments made according to Section 1-09.9 for the following bid items when they are included in the proposal: 212th St. Preservation/Holcomb SP - 102 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 “HMA Cl. ___ PG ___” “HMA for Approach Cl. ___ PG ___” “HMA for Preleveling Cl. ___ PG ___” “HMA for Pavement Repair Cl. ___ PG ___” “Commercial HMA” The adjustment is not a guarantee of full compensation for changes in the cost of asphalt binder. The Contracting Agency does not guarantee that asphalt binder will be available at the reference cost. The Contracting Agency will establish the asphalt binder reference cost twice each month and post the information on the Agency website at: http://www.wsdot.wa.gov/Business/Construction/EscalationClauses.htm The reference cost will be determined using posted prices furnished by Poten & Partners, Inc. If the selected price source ceases to be available for any reason, then the Contracting Agency will select a substitute price source to establish the reference cost. The base cost established for this contract is the reference cost posted on the Agency website with an effective date immediately preceding the bid opening date. Adjustments will be based on the most current reference cost for Western Washington or Eastern Washington as posted on the Agency website, depending on where the work is performed. For work completed after all authorized working days are used, the adjustment will be based on the posted reference cost during which contract time was exhausted. The adjustment will be calculated as follows: No adjustment will be made if the reference cost is within 5% of the base cost. If the reference cost is greater than or equal to 105% of the base cost, then Adjustment = (Current Reference Cost – (1.05 x Base Cost)) x (Q x 0.056). If the reference cost is less than or equal to 95% of the base cost, then Adjustment = (Current Reference Cost – (0.95 x Base Cost)) x (Q x 0.056). Where Q = total tons of all classes of HMA paid in the current month’s progress payment. “Asphalt Cost Price Adjustment”, by calculation. “Asphalt Cost Price Adjustment” will be calculated and paid for as described in this section. For the purpose of providing a common proposal for all bidders, the Contracting Agency has entered an amount in the proposal to become a part of the total bid by the Contractor. 5-05 CEMENT CONCRETE PAVEMENT SECTION 5-05.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 103 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 5-05.3 Construction Requirements (Kent Special Provision) Curing blankets or other methods approved by the Engineer shall be used to accelerate curing time where necessary. The cement concrete pavement must develop a comprehensive strength of 2,500 psi within 3-days and prior to opening the cement concrete pavement to traffic. Materials, labor, and equipment used for accelerated curing shall be approved by the Engineer and shall be incidental to bid item “Cement Conc. Pavement.” SECTION 5-05.3(8)D IS DELETED AND REPLACED WITH THE FOLLOWING: 5-05.3(8)D Isolation Joints (Kent Special Provision) Precast rubber spacer shall be placed as detailed in the plans through the full depth of concrete pavement. 212th St. Preservation/Holcomb SP - 104 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 7 – DRAINAGE STRUCTURES, STORM SEWERS, SANITARY SEWERS, WATER MAINS AND CONDUITS 7-05 MANHOLES, INLETS, CATCH BASINS, AND DRYWELLS SECTION 7-05.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 7-05.3 Construction Requirements (Kent Special Provision) Manhole frame and covers shall be cast gray or ductile iron and shall comply with WSDOT Standard Plan B-30.70. New lids shall read “SEWER” for sanitary sewer or “STORM” for storm sewer drain. ADA Frame and Grate shall conform to WSDOT Standard Plan B-30.15 Alternative 1. ADA Locking Frame and Grate shall conform to WSDOT Standard Plan B-30.15 and shall be non-skid as described in KSP 8-20.3(6). Care must be taken to insure that pressures exerted on the soils beneath the manholes and the adjacent mains are approximately uniform. Unequal soil pressures may result in excessive settlement at manholes. A spread foundation or other measures may be required to reduce the unit load imposed by the manhole. SECTION 7-05.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 7-05.3(1) Adjusting Manholes and Catch Basins to Grade (Kent Special Provision) All construction in performing adjustments of existing or new utilities shall conform to the WSDOT Standard Specifications, Standard Plans, Kent Standard Plans and the Kent Special Provisions. Locating all new and existing utilities to be adjusted following the paving shall be the responsibility of the Contractor. The Contractor shall mark or reference all affected utilities including traffic loops prior to paving. Should it be determined by City personnel upon inspection or by notification from other utility companies that the Contractor has failed to adjust existing utilities, the Contractor shall be responsible for completing the adjustments, at no additional cost to the utility company or the City, even if the Contractor has vacated the project site. If the Contractor neglects to reference utilities prior to paving, and for example causes conflicts with or damage to traffic loops, the Contractor shall be responsible to relocate or replace the traffic loops at no additional cost to the City. 212th St. Preservation/Holcomb SP - 105 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 No less than 4 inches or greater than 16 inches shall be provided between the top of the cone and the underside of the manhole frame for adjustment to street grade or ground surface. Final elevation and slope of the frame and cover shall conform to the final street surface. All joints in the brick or ring adjustment shall be filled with grout, and the castings shall be sealed in grout placed on the ring or brick. A 3/8 inch mortar lining shall be installed inside and out of the adjustment section to form a smooth watertight finish. NOTE: The use or presence of wood, asphalt, expansion joint material or other non-approved product for catch basin or manhole adjustment shall be cause for immediate rejection. On asphalt concrete paving and/or asphalt resurfacing projects, manholes, catch basins and similar structures shall not be adjusted until the pavement is completed, at which time the center of each structure shall be relocated from references previously established by the Contractor. The pavement shall be cut in a restricted area and base material removed to permit removal of the cover. The asphalt concrete pavement shall be cut and removed to a neat circle, the diameter of which shall be equal to the outside diameter of the frame plus two feet. The frame shall be placed on concrete blocks and fully mortared to the desired grade. The base materials and crushed rock shall be removed and Cement Concrete Class 3000 shall be placed so that the entire volume of the excavation and up to within, but not to exceed 1-1/2 inches of the finished pavement surface. Note: casting adjustments shall be made with cementitious materials only. Wood, plastic, iron, aluminum, bituminous or similar materials are prohibited. On the following day, the concrete, the edges of the asphalt concrete pavement, and the outer edge of the casting shall be painted with hot asphalt cement. Asphalt concrete shall then be placed and compacted with hand tampers and a patching roller. The completed patch shall match the existing paved surface for texture, density, and uniformity of grade. The joint between the patch and the existing pavement shall then be painted with hot asphalt cement or asphalt emulsion and shall be immediately covered with dry paving sand before the asphalt cement solidifies. SECTION 7-05.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 7-05.5 Payment (Kent Special Provision) “Adjust Existing Manhole Cover to Finished Grade” “Adjust Existing Metro Manhole to Finished Grade” The unit contract price per each for the above items constitutes complete compensation for all labor, materials, tools, supplies and equipment necessary to adjust the specified structure to final finished grade as shown on the plans and described in the specifications. King County Wastewater (Metro) to provide new manhole frame and cover to replace the existing cover. All costs associated with replacing the frame and cover and disposing of the existing cover shall be included in the “Adjust Existing Metro Manhole to Finished Grade” bid item. This work includes but is not limited to: excavating, dewatering, installing, connecting new or existing pipes, backfilling, compacting, surfacing, restoration, regrouting as 212th St. Preservation/Holcomb SP - 106 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 determined by the Engineer and referencing for future locates prior to final overlay. Adjusting the grade by adding or removing risers, grade rings or sections as required will be included in this bid item. Any adjustments made prior to the final finished elevation shall be considered incidental. The unit contract price per each for “Replace Existing Manhole Lid and Adjust to Finished Grade” constitutes complete compensation for all labor, materials, tools, supplies and equipment necessary to replace the existing manhole lid, adjusting to the planed grade, and adjusting to final finished grade as shown on the plans and described in the specifications. The unit price bid shall include but not be limited to excavating; dewatering; backfilling; compacting; surface restoration; removing and disposing the existing manhole lid, and providing and installing the new manhole lid. Adjusting the grade by adding or removing risers, grade rings, or sections as required will be included in this bid item. Any adjustments made prior to the final finished elevation shall be considered incidental. Any frames, grates, or risers shall be hauled and disposed of by the Contractor unless deemed salvageable as determined by the Engineer. Reference WSDOT Standard Plan B- 30.70-03. The unit contract price per each for “Replace Existing Rectangular Frame and Cover with Round Frame and Cover” constitutes complete compensation for all labor, materials, tools, supplies and equipment necessary to replace the existing rectangular frame and cover with a round frame and cover per WSDOT Standard Plan B-30.70-03. The unit price bid shall include but not be limited to excavating; dewatering; backfilling; compacting; surface restoration; removing and disposing of the existing manhole lid, providing and installing the new square to round converter, providing and installing the new manhole lid, adjusting to the planed grade, and adjusting to final finished grade. Adjusting the grade by adding or removing risers, grade rings, or sections as required will be included in this bid item. Any adjustments made prior to the final finished elevation shall be considered incidental. Any frames, grates, or risers that are removed shall be hauled and disposed of by the Contractor unless deemed salvageable as determined by the Engineer. 7-12 VALVES FOR WATER MAINS SECTION 7-12.2 IS REVISED BY SUPPLEMENTING THE FIRST PARAGRAPH WITH THE FOLLOWING: (******) 7-12.2 Materials (Kent Special Provision) The following materials shall meet the requirements of the following sections of the Kent Special Provisions: Valve Boxes ................................................. 9-30.3(4) SECTION 7-12.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 107 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 7-12.3 Construction Requirements (Kent Special Provision) All valves shall have valve boxes installed with the cover lugs parallel to the direction of water flow. SECTION 7-12.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTIONS: (******) 7-12.3(2) Replace Existing Valve Box Top Section and Lid (Kent Special Provision) New Section See Section 9-30.3(4) of the Kent Special Provisions for material specifications. Where shown in the plans or where directed by the Engineer, the Contractor shall furnish and install new Valve Box Top Section and Lid on existing water valves in accordance with the details shown in the plans, these Kent Special Provisions or as directed by the Engineer. Lid shall be the locking type. On asphalt concrete paving and/or asphalt resurfacing projects, valve box top section and similar structures shall not be adjusted and/or installed until the pavement is completed. The center of each structure shall be relocated from previously referenced measurements, established by the Contractor. The pavement shall be cut in a restricted area and base material removed to permit removal of the old unit. The new structure shall then be installed to proper grade utilizing the same methods of construction as specified for new construction in Section 7-12 of the WSDOT Standard Specifications and the Kent Special Provisions. All valves covered by new paving shall be uncovered and adjusted to grade within 72 hours. SECTION 7-12.5 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 7-12.5 Payment (Kent Special Provision) Payment will be made in accordance with Section 1-04.1, for the following bid items when they are included in the Proposal: The unit price bid per each for “Replace Existing Valve Box Top Section and Lid, and Adjust to Finished Grade” constitutes complete compensation for all labor, materials and equipment required to furnish and install the valve box top and lid, adjust the existing top to the planed grade, and adjust the new top to final grade after the final lift of asphalt is placed. The costs of excavating, removing and disposing of the existing valve box top and lid are included in the unit bid price for replacing the valve box top and lid. Reference Kent Standard Plan 3-7. 212th St. Preservation/Holcomb SP - 108 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 8 – MISCELLANEOUS CONSTRUCTION 8-01 EROSION CONTROL AND WATER POLLUTION CONTROL SECTION 8-01.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.1 Description (Kent Special Provision) This work consists of temporary erosion and sedimentation control procedures (TESCP) as shown on the construction plans, specified in these Kent Special Provisions, and ordered by the Engineer as work proceeds. The TESCP are intended to minimize erosion and sedimentation as well as protect waters of the state and the city’s municipal separate storm sewer system (MS4) as required by law. The TESCP measures shown on the plans and described in the specifications shall only apply to work within the project limits and does not apply to the Contractor’s staging area. The Contractor shall be responsible for providing TESCP at any staging area(s). All TESCP used at the staging area(s) shall be incidental to the project. The Contractor shall be responsible for any fine(s) imposed by Ecology or any other regulatory agency for any violation at their staging are(s). The Contractor shall also be responsible for any cost of cleanup, delays, and down time to correct any deficiencies at the staging area(s). No construction related activity shall contribute to the degradation of the environment, allow material to enter surface or ground waters, or allow particulate emissions to the atmosphere, which exceed state or federal standards. Any actions that potentially allow a discharge to the state waters must have prior approval of the Washington State Department of Ecology. SECTION 8-01.2 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.2 Materials (Kent Special Provision) Materials shall meet the requirements of the following sections of the Kent Special Provisions and the WSDOT Standard Specifications: Seed ................................................. 9-14.3 Fertilizer ............................................ 9-14.3 Mulch and Amendments ....................... 9-14.5 Tackifier ............................................. 9-14.5(7) 8-01.3 Construction Requirements SECTION 8-01.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 109 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 8-01.3(1) General (Kent Special Provision) Preventing and controlling pollution, erosion, runoff, and related damage requires the Contractor to install temporary stormwater best management practices (BMPs) as per the plans and as directed by the City. As site conditions dictate, additional BMPs may be required. The Contractor shall anticipate the need for additional best management practices and propose necessary changes to the City. Should the Contractor fail to install the required temporary erosion and sediment control (TESC) measures or to perform maintenance in a timely manner, or fail to take immediate action to install additional approved measures, all fines, cost of cleanup, costs for delays and down time shall be borne by the Contractor. All cost for this work shall be paid for under the unit contract bid prices. The upgrading of the TESCP facilities shall not constitute a basis for additional working days for this project. The Contractor shall provide the Engineer a minimum of two working days notice prior to clearing adjacent to any wetland, creek or other sensitive area. During the construction period, no disturbance beyond the flagged clearing limits shall be permitted. The flagging shall be maintained by the Contractor for the duration of construction. The TESC facilities shall be in accordance with and conform to the Kent Surface Water Design Manual, the WSDOT Standards Specifications, and the Ecology Construction Stormwater General Permit (if applicable), except as modified by the Kent Design and Construction Standards or these Kent Special Provisions. It shall be the responsibility of the Contractor to notify the City at once of any TESC deficiencies or changes in conditions such as rutting and or erosion that may occur during construction. The Contractor may recommend possible solutions to the Engineer in order to resolve any problems that are occurring. The requirements of this section shall apply to all areas of the site subject to construction activity as described in the WSDOT Standard Specifications, the Kent Special Provisions and contract plans, including Contractor construction support facilities, Contractor personnel parking areas, equipment and material storage/laydown areas, and other areas utilized by the Contractor for completion of the work. Nothing in this section shall relieve the Contractor from complying with other contract requirements. SECTION 8-01.3(1)A IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.3(1)A Submittals (Kent Special Provision) 212th St. Preservation/Holcomb SP - 110 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Prior to the start of any construction activities, the Contractor shall submit for the Engineer’s review and approval, the following, as necessitated by the work: 1. Dewatering Plan 2. Spill Prevention Control and Countermeasures Plan 3. Stream Bypass Plan for in-water work 4. Name and contact info for Contractor’s CESCL SECTION 8-01.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTIONS: (******) 8-01.3(1)F Applicable Regulations and Criteria (Kent Special Provision) New Section All construction activities are subject to applicable federal, state, and local permits. The Contractor shall comply with requirements of applicable state and local regulatory requirements, including, but not limited to the following: 1. WAC 173-201A Water Quality Standards for Surface Waters of the State of Washington 2. RCW 90.48.080 Discharge of pollutants in waters prohibited 3. City of Kent 2002 Surface Water Design Manual 4. Construction Stormwater General Permit – WA Department of Ecology (******) 8-01.3(1)G Water Quality Monitoring (Kent Special Provision) New Section Sampling of site stormwater discharges is only required if the project is covered under the WA Department of Ecology Construction Stormwater General Permit or if there is a suspected discharge that exceeds state water quality standards. If the project is covered under the Construction Stormwater General Permit, then the Contractor shall conduct sampling as per the conditions listed in the permit. Any results that are outside the appropriate range of compliance will require immediate implementation of adaptive management as outlined in applicable permits, stormwater pollution prevention plan, and as directed by the Engineer. All sampling records shall be submitted to the Engineer by the last day of the monitoring period. All necessary adaptive management requirements shall be the responsibility of the Contractor to implement and maintain. All costs for this work shall be included in the various unit contract bid prices. SECTION 8-01.3(2)E IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.3(2)E Tackifiers 212th St. Preservation/Holcomb SP - 111 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (Kent Special Provision) Unless specified otherwise, wood cellulose fiber mulch per Section 9-14(5)10 of the Standard Specifications shall have tackifier incorporated into the mulch fiber during manufacture. If additional tackifier is required, the tackifier shall be organic tackifier as specified in Section 9-14.5(7)A of the WSDOT Standard Specifications. When specified, tackifiers shall be applied in accordance with the manufacturer's recommendations. 8-01.3(9) Sediment Control Barriers SECTION 8-01.3(9)D IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.3(9)D Inlet Protection (Kent Special Provision) Cleaning and maintenance of inlet protection shall not flush sediment, or sediment- laden water into the downstream system. SECTION 8-01.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 8-01.3(17) Vehicle Maintenance and Storage (Kent Special Provision) Handling and storage of fuel, oil and chemicals shall not take place within 50 feet of waterways. Storage shall be in dike tanks and barrels with drip pans provided under the dispensing area. Shut-off and lock valves shall be provided on hoses. Fuel, oil, and chemicals shall be dispensed only during daylight hours unless approved by the engineer. Fencing shall be provided around storage area. Locks shall be provided on all valves, pumps, and tanks. Materials used to clean up fuel, oil, and chemical spills shall be disposed of as directed by the engineer. Water used for washing vehicles and equipment shall not be allowed to enter storm drains or other State waters. No processed waste water(s) of any kind shall be discharged onto the ground, to surface waters, or to stormwater conveyance systems. SECTION 8-01.5(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-01.5(2) Item Bids (Kent Special Provision) The unit contract price per square yard for “Seeding, Fertilizing, and Mulching” shall be full pay for all labor, materials tools and equipment necessary to complete 212th St. Preservation/Holcomb SP - 112 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 the above said hydroseeding, seeding, fertilizing and mulching at the locations shown on the plans, including the following areas: 1. All planter areas or areas disturbed by the Contractor's operations behind the sidewalk, even where it is only a narrow strip. 2. All biofiltration swales. 3. Detention pond site. 4. Other areas as directed by the Engineer. Water, fertilizer and mulch shall be provided by the Contractor as necessary to maintain and establish the seeded areas and is considered incidental to this bid item. Topsoil Type B is considered incidental to this bid item unless a specific bid item is listed in the proposal. The cost of baffling or blocking over spray as required to prevent over spray onto the sidewalk, curbing and non-planter areas is incidental to the unit price. The unit contract price per each for “Inlet Protection” shall be full pay for furnishing all labor, materials, tools and equipment necessary to construct, maintain, and remove when no longer required, this temporary erosion control measure. No other further compensation will be made. The unit bid price per square yard for “Straw Mulch” constitutes complete compensation for all materials, tools, labor and equipment required for applying straw mulch on exposed soils for erosion control as directed by the Engineer. Straw shall be in an air-dried condition, and free of noxious weeds and other materials detrimental to plant life. The unit price per square yard for “Clear Plastic Covering” (6 mil polyethylene sheets) shall constitute complete compensation for furnishing, staking, maintaining and protecting, the material in place (including sand bags and stakes) on all exposed soils per the WSDOT Standard Specification and as directed by the Engineer. The unit contract price per hour for “ESC Lead” shall be full pay for all duties outlined in Section 8-01.3(1)B (Erosion and Sediment Control (ESC) Lead) in per hour increments. 8-02 ROADSIDE RESTORATION SECTION 8-02.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.1 Description (Kent Special Provision) Drawings and Specifications: Definitions: The word “provide” means “furnish and install” (for landscaping only). Dimensions and Measurements: Dimensions govern when shown. Scale is approximate. Contractor shall check all dimensions in the field and verify them 212th St. Preservation/Holcomb SP - 113 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 with respect to adjacent or incorporated work. Any discrepancies in the drawings shall be brought to the immediate attention of the Engineer before work proceeds further. Number of Specified Items Required: Wherever in these Kent Special Provisions an article, device or piece of equipment is referred to in the singular number, such reference shall include as many such items as are shown on drawings or required to complete the installation. SECTION 8-02.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 8-02.1(1) Submittals (Kent Special Provision) New Section The Contractor shall submit within 20 days after Notice to Proceed date a list of all plant material indicating source of supply, order invoice, size and quantity for such species or variety. All plant materials shall meet requirements of State and Federal laws with respect to inspection for plant diseases and infestations. Inspection certificates required by law shall accompany each shipment of plant material and submitted to the Engineer. SECTION 8-02.2 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-02.2 Materials (Kent Special Provision) Materials shall meet the requirements of the following sections: Topsoil Type A, Type B, and Type C .............................. 9-14.2(1), (2), (3) Seed ..................................................................... 9-14.3 Fertilizer .................................................................. 9-14.4 Mulch and Amendments ............................................. 9-14.5 Wood Cellulose Fiber .................................................. 9-14.5(10) Erosion Control Devices .............................................. 9-14.6 Plant Materials .......................................................... 9-14.7 Street Trees ............................................................. 9-14.7(1)A Stakes, Guys and Wrapping ........................................ 9-14.8 Tree Ties .................................................................. 9-14.8(1) Water for Plants ........................................................ 9-25.2 Botanical identification and nomenclature of plant materials shall be based on descriptions by Bailey in “Hortus Third” or superseding editions and amendments. 8-02.3 Construction Requirements 212th St. Preservation/Holcomb SP - 114 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-02.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(1) Responsibility During Construction (Kent Special Provision) The Contractor shall at all times keep the planted areas free from accumulations of waste materials or rubbish. Upon completion of the planting work, the Contractor shall immediately remove all refuse and debris resulting from the planting activities. The project will not receive either preliminary or final approval if the cleanup does not meet with the approval of the Engineer. SECTION 8-02.3(3) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(3) Weed and Pest Control (Kent Special Provision) During the maintenance period, all weeds are to be removed by hand. 8-02.3(9) Seeding, Fertilizing and Mulching SECTION 8-02.3(9)A IS REVISED BY DELETING THE FIRST THREE PARAGRAPHS AND REPLACING WITH THE FOLLOWING: (******) 8-02.3(9)A Dates for Application of Seed (Kent Special Provision) Unless otherwise approved by the Engineer, the final application of seeding, fertilizing, and mulching of slopes shall be performed during the following periods: West of the summit of the Cascade Range - March 1 to May 15 and August 15 to October 1. Where contract timing is appropriate, seeding, fertilizing, and mulching shall be accomplished during the spring period listed above. Written permission to seed after October 1 will only be given when physical completion of the project is imminent and the environmental conditions are conducive to satisfactory growth. SECTION 8-02.3(9)B IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-02.3(9)B Seeding and Fertilizing (Kent Special Provision) Topsoil and all other unpaved and unsodded areas within easements and right-of-way disturbed as part of this project shall be seeded. Hydroseeding shall be the method of seed application. Hydroseed shall consist of a slurry composed of water, seed, fertilizer, tackifier, and mulch and shall be evenly broadcast over areas to be seeded. All work 212th St. Preservation/Holcomb SP - 115 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 shall conform in all respects to Section 8-01 of the WSDOT Standard Specifications, except as modified herein. The Contractor shall notify the Engineer not less than 48 hours in advance of any hydroseeding operation and shall not begin the work until areas prepared or designated for hydroseeding have been approved. Following the Engineer's approval, hydroseeding of the approved slopes shall begin immediately. Hydroseeding shall not be done during windy weather or when the ground is frozen, excessively wet, or otherwise untillable. Hydroseed mixture to be applied by an approved hydro seeder which utilizes water as the carrying agent, and maintains continuous agitation through paddle blades. It shall have an operating capacity sufficient to agitate, suspend, and mix into a homogeneous slurry the specified amount of seed and water or other material. Distribution and discharge lines shall be large enough to prevent stoppage and shall be equipped with a set of hydraulic discharge spray nozzles that will provide a uniform distribution of the slurry. The seed and fertilizer cannot be placed in the tank more than 30 minutes prior to application. The seed and fertilizer shall have a tracer added to visibly aid uniform application. This tracer shall not be harmful to plant and animal life. If wood cellulose fiber is used as a tracer, the application rate shall not exceed 25 pounds per acre. Areas where hydroseeding is not practical, must be seeded by approved hand methods as approved by the engineer. When seeding by hand, Contractor shall incorporate seed into the top 1/4 inch of soil. The hydroseed slurry shall consist of the following materials mixed thoroughly together and applied in the quantities indicated. 1. Grass Seed: Mixture shall be fresh, clean, new crop seed. Seed to be mixed mechanically on the site or may be mixed by the dealer. If seed is mixed on site, each variety shall be delivered in the original containers bearing the dealer’s guaranteed analysis. If seed is mixed by the dealer, the Contractor shall furnish to the Engineer the Dealer’s guaranteed statement of the composition of the mixture and the percentage of purity and germination of each variety. Grass seed shall be purchased from a recognized distributor and shall be composed of the varieties mixed in the proportions indicated in the WSDOT Standard Specifications and Kent Special Provisions. Seed shall meet the minimum percentages of purity and germination specified in Section 9-14.2 of the Kent Special Provisions. Seed shall be applied at the rate of 120 pounds per acre. The Contractor shall protect seed from hydration, contamination, and heating during delivery, storage, and handling. Seed shall be stored in a cool dry location away from contaminants. 212th St. Preservation/Holcomb SP - 116 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Mix A shall be used as the standard hydroseed mix unless otherwise specified herein or on approved project plans. Mix B shall be used exclusively for seeded areas adjacent to grass lawns, within seeded medians, and within seeded traffic islands. In addition, Mix B shall be used for all seeded areas not specifically showing Mix A on the plans, or where otherwise directed by the Engineer. 2. Water: The Contractor shall begin maintenance immediately after seeding for a minimum of ten (10) weeks or longer as needed. Water seeded areas before hydroseed slurry has completely dried out. Water slowly and thoroughly with fine spray nozzle. Water the hydroseeded areas at least twice daily (in the early morning and late afternoon) until the grass is well established as determined by the Engineer. Repeat watering operation as required by climatic conditions to keep areas moist for a minimum period of 2 weeks from the day of first watering and as necessary for healthy growth. 3. Mulch: As needed to meet requirements of Sections 8-01.3(2)D and 9-14.4. 4. Fertilizer: All areas which are seeded shall receive fertilizer of the following proportions and formulation applied at the rate of 400 pounds per acre. All areas which are seeded shall receive fertilizer meeting the requirements of Section 9-14.3 of the Kent Special Provisions. Fertilizer shall not be applied on any creek sideslopes in order to avoid contamination of these creeks. 5. Hand Seeding: Seeding shall be applied at the rate of 6 pounds per 1,000 square feet. The seed shall be applied by an approved hand held spreader. The seed shall be evenly distributed over the disturbed area. Apply seed mix after fertilizing and rake the seed into the surface soil to a depth of 1/4-inch. 6. If the slurry is used for temporary erosion control it shall be applied at the following rates: EROSION CONTROL: Seed 170 lbs/acre of “Mix A” unless otherwise directed by Engineer. Fertilizer 400 lbs/acre Wood Fiber 2,000 lbs/ acre Tackifier 80 lbs/acre SECTION 8-02.3(9)D IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(9)D Inspection (Kent Special Provision) Inspection of seeded areas shall be made upon completion of seeding operations, at the end of the maintenance period, and at any time during the maintenance period. The Contractor shall reseed, re-mulch or re-fertilize as required to 212th St. Preservation/Holcomb SP - 117 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 establish a uniform, thick stand of grass. A uniform stand of grass shall be defined as any grass area with no spots greater than one square foot. Areas failing to show a uniform thick, healthy stand of grass after the maintenance period shall be reseeded consistent with the Kent Special Provisions at the Contractor's expense. Reseeded areas will be subject to inspection for acceptance. SECTION 8-02.3(9)E IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(9)E Protection and Care of Seeded Areas (Kent Special Provision) Protect adjacent property, public walks, curbs and pavement from damage. Do not place soil directly on paved surfaces. Locate all underground utilities prior to the commencement of work. Keep streets and area drains open and free flowing. Protect all seeding against wind, storm, and trespassing. Replace any plants that become damaged or injured. In seeded areas, treat and reseed damaged spots larger than one square foot. SECTION 8-02.3(11)A IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-02.3(11)A Mulch for Seeding Areas (Kent Special Provision) Wood cellulose fiber mulch conforming to Section 9-14.5(10) of the Standard Specifications shall be used where mulch is called for on this project. The application rate shall be 2,000 pounds to the acre in accordance with Section 8-01 of the WSDOT Standard Specifications. Mulch shall be incorporated into the slurry of seed and fertilizer. Mulch of the type specified in Section 9-14.5 shall be included in the hydroseeding process. Wood cellulose fiber used as a mulch shall be suitable for application with hydroseeders as specified in Section 8-01.3(9)B. The application of seed, fertilizer, and mulch shall be required in a single operation for all seed applications, unless otherwise directed. Mulch materials, shall be furnished, hauled, and evenly applied at the rates indicated, and shall be spread on seeded areas immediately after seeding unless otherwise specified. Distribution of straw mulch material shall be by means of an approved type mulch spreader, which utilizes forced air to blow mulch material on seeded areas. In spreading straw mulch, the spreader shall not cut or break the straw into short stalks. Straw mulch shall be applied at a rate to achieve a loose, overall thickness of three (3) inches. Areas not accessible by mulching equipment shall be mulched by approved hand methods and shall achieve similar results. Mulch sprayed on signs or sign structures shall be removed the same day. 212th St. Preservation/Holcomb SP - 118 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-02.3(13) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(13) Plant Establishment (Kent Special Provision) The Contractor is responsible for maintaining all trees and shrubs in a clean and thriving condition for a period of not less than two calendar years. The period of maintenance shall begin upon final installation and inspection of work, and subsequent written notification by the Engineer. Maintenance shall include all necessary cleaning, weeding, pruning, watering, and one supplemental feeding with approved fertilizer. The Contractor shall water all trees and shrubs a minimum of once per week during the months of June through September to establish the vegetation during the dry summer months. Maintenance of this watering schedule is critical to the survival of the trees and shrubs. SECTION 8-02.3(14) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.3(14) Plant Replacement (Kent Special Provision) The Contractor shall replace all trees and shrubs which, in the opinion of the City Nursery Supervisor, have failed to establish themselves during the maintenance period at its sole expense. All replacement planting shall be conducted in conformance to these specifications. SECTION 8-02.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 8-02.3(17) Plant and Site Protection During Entire Construction Period (Kent Special Provision) New Section The Contractor shall: 1. Protect existing trees to remain and new plants against injury and damage, including but not limited to: cutting, breaking, or skinning of roots, trunk or branches, or smothering by stockpiling construction material, or compaction by equipment. 2. Keep all heavy equipment (e.g., backhoe) outside of the drip lines of all existing trees, so as not to damage the root systems. 3. Notify Engineer immediately if a conflict arises between construction activity and the protection of trees and shrubs; alter methods as necessary and as approved by the Engineer. 212th St. Preservation/Holcomb SP - 119 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-02.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-02.5 Payment (Kent Special Provision) The unit contract price per cubic yard for “Topsoil Type A” constitutes complete compensation for all labor, materials, tools and equipment necessary to supply and spread the topsoil in the areas shown on the plans, or where directed by the Engineer. This item includes but is not limited to the labor required for raking and compacting the topsoil, cleanup and complete preparation ready for seeding. 8-04 CURBS, GUTTERS, AND SPILLWAYS 8-04.3 Construction Requirements SECTION 8-04.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-04.3(1) Cement Concrete Curbs, Gutters and Spillways (Kent Special Provision) If the curb and gutter flow line is found to deviate from the existing flow line by more than 0.03 foot, the Contractor shall remove the faulty section of curb and gutter and replace it with a new section meeting specifications. The removal and replacement shall be at no cost to the City. Precast Concrete Sloped Mountable Curb shall be installed at the locations indicated on the plans or where directed by the Engineer. See WSDOT Standard Plan F-10.62-02. SECTION 8-04.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: 8-04.3(3) Painting of Curbs Concrete curbing shall be painted with two full coats of appropriate color paint (Yellow, or White) as approved by engineer or shown on the plans, using Low VOC Solvent Based Paint conforming to Section 9-34, wide enough to completely cover the concrete curbing without painting adjacent surfaces. Prepare existing curbing to be painted by removing organic material near the curb, scrape off existing loose paint, and clean oil spills. The paint can be applied by brush or spray. The second coat shall have glass traffic paint beads sprinkled in the wet paint at the rate of 12 pounds per 100 linear feet of curbing. The beads shall conform to the requirements of Section 9- 34.4. 212th St. Preservation/Holcomb SP - 120 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-04.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: 8-04.4 Measurement The measurement for “Painting Traffic Curb” will be based on the length of painted curb in accordance with Section 8-04.3(3) and accepted by the Engineer. No additional measurement will be made for curbing painted on both sides of the curbing. SECTION 8-04.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-04.5 Payment (Kent Special Provision) “Cement Concrete Curb and Gutter” “Precast Concrete Sloped Mountable Curb” The unit contract price per linear foot for the above items shall be complete compensation for all materials, labor, tools, supplies and equipment required to install the curbs in accordance with the plans, specifications and as directed by the Engineer. Also included in this bid item includes the cost to salvage and reuse the existing metal curb inlet. “Precast Concrete Sloped Mountable Curb” shall be painted yellow and shall be paid for under the “Painting Traffic Curb” bid item. The unit contract price per linear foot for “Cement Concrete Curb and Gutter, 8 Inch Depth, Reinforced” shall be considered complete compensation for all materials, labor, tools and equipment required to install the curbs in accordance with the plans, specifications and as directed by the Engineer. This bid item also include supplying and installing the reinforcing steel in accordance with Kent Standard Plan 6-44, specifications, and as directed by the Engineer. The unit contract price per linear foot for “Cement Concrete Extruded Curb, Type 4” shall be complete compensation for all materials, labor, tools, supplies and equipment required to install and mount the curbs in accordance with the plans, specifications and as directed by the Engineer. Cement Concrete Extruded Curb, Type 4 shall conform to WSDOT Standard plan F-10.42 but shall be a total of 18 inches wide. The unit contract price per linear foot for “Painting Traffic Curb” shall be considered complete compensation for all materials, labor, tools, and equipment required to paint the cement concrete curb in accordance with the plans, specifications and as directed by the engineer. This bid item includes removing the peeled paint from the existing curbs and cleaning the curbs before painting to the point of satisfaction of engineer. Existing HOV traffic curb shall be painted white and “Precast Concrete Sloped Mountable Curb” shall be painted yellow. 8-05 MONITORING WELL SECTION 8-05 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 121 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 8-05.5 Payment (Kent Special Provision) The unit contract price per each for “Adjust Existing Monitoring Well Lid to Finished Grade” constitutes complete compensation for all labor, materials, tools, supplies and equipment necessary to adjust the monitoring well valve box top to the planed grade and final finished grade as shown on the plans and described in the specifications. 8-06 CEMENT CONCRETE DRIVEWAY ENTRANCES SECTION 8-06.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-06.3 Construction Requirements (Kent Special Provision) Cement Concrete Driveways shall be installed at the locations indicated on the plans or where directed by the Engineer. See Kent Standard Plan 6-44. All sidewalk cross slopes shall be ADA compliant and shall not exceed 2%. Cement concrete driveways and associated cement concrete curb drops shall be constructed using a 3-day mix. In addition, the Contractor shall immediately implement temporary provisions for access so that no driveway is out of service. Also the Contractor shall not simultaneously work on more than one driveway serving a property. SECTION 8-06.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-06.5 Payment (Kent Special Provision) The unit contract price per square yard for “Cement Concrete Driveway, 8 Inch Depth, Reinforced” constitutes complete compensation for all materials, labor and equipment required to install 8” thick cement concrete driveway in accordance with the plans and specifications. Reinforcing steel in the driveway shall be included in this bid item. Reference Kent Standard Plan 6-44. 8-09 RAISED PAVEMENT MARKERS SECTION 8-09.1 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-09.1 Description (Kent Special Provision) 212th St. Preservation/Holcomb SP - 122 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 This work shall consist of furnishing, and installing new pavement markers of the type specified in the plans upon the roadway surface in accordance with applicable Kent Standard Plans and/or WSDOT Standard Plans at locations shown in the Contract or as directed by the Engineer. Removal of existing pavement markers shall be included in the unit bid price for this item unless otherwise specified. Unless otherwise noted, pavement markings shall be installed in strict conformance to Kent Standard Plans 6-74. 8-09.3 Construction Requirements SECTION 8-09.3(1) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-09.3(1) Preliminary Spotting (Kent Special Provision) The Engineer will provide control points at the locations and intervals determined necessary by the City to assist in preliminary spotting of the lines before the placement of raised pavement markers begins. The Contractor shall be responsible for preliminary spotting of the lines to be marked. Approval by the Engineer is required before the placement of raised pavement markers begins. Preliminary spotting to guide the placement of raised pavement markers is required for all longitudinal lines. Preliminary spotting for each lane of raised pavement markers shall be provided at transition points required by Kent Standard Plan 6-74, RPM Substitution Patterns. SECTION 8-09.3(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-09.3(2) Surface Preparation (Kent Special Provision) In removing raised pavement markers and plastic traffic buttons, the Contractor shall: 1. Haul broken-up pieces of raised pavement markers, plastic traffic buttons and all waste material to an off-project site, unless otherwise directed by the Engineer, or permitted by the Kent Special Provisions. 2. Remove all sand, or other waste materials deposited on the pavement, or within the City’s stormwater management system, as a result of the removal process selected by the Contractor. 3. Install temporary lane markings at their sole expense, unless the street is going to be remarked, or overlaid immediately after the completed removal of raised pavement markers and/or plastic traffic buttons. 4. Take suitable care so as not to damage the underlying pavement surface more than necessary, clean all underlying pavement, including the complete removal of all remaining adhesive, and fill any surface voids caused by the removal work. 212th St. Preservation/Holcomb SP - 123 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 8-10 GUIDE POSTS SECTION 8-10.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-10.1 Description (Kent Special Provision) This work shall consist of furnishing and installing traffic pylons. SECTION 8-10.2 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-10.2 Materials (Kent Special Provision) The pylons shall be constructed of UV-stabilized thermo=plastic polyurethane (TPU). Pylons shall comply with Section 9-17.3 and conform to the dimension in the Plans. Reflective sheeting shall be one of the following preapproved products: 3M High Intensity Sheeting Reflexite PC 1 000 Dura-brite SECTION 8-10.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-10.3 Construction Requirements (Kent Special Provision) The pylon system shall be a surface mounted assembly that uses a separate base with a detachable pylon held in place by means of a locking device as shown in the Plans. Installation of the pylon devices shall be with a bituminous adhesive meeting the requirements of 9-02.1 (8) rather than the epoxy adhesive specified in Section 9- 26. The bituminous adhesive shall not be heated above the maximum safe heating temperature recommended by the manufacturer and shall not be applied at temperature greater than 425 degrees F nor less than 375 degrees F. SECTION 8-10.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-10.4 Measurement (Kent Special Provision) 212th St. Preservation/Holcomb SP - 124 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Traffic pylon will be measured by the unit for each pylon furnished and installed. SECTION 8-10.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-10.5 Payment (Kent Special Provision) "Traffic Pylon," per each. 8-13 MONUMENT CASES SECTION 8-13.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: 8-13.1 Description (Kent Special Provision) This work also consists of adjusting existing monument case by placing risers with appropriate height and diameter to finished grade. The existing monument and casing shall not be disturbed. This work also includes referencing for future locates prior to construction activities. SECTION 8-13.2 IS SUPPLEMENTED BY ADDING THE FOLLOWING: 8-13.3 Construction Requirements (Kent Special Provision) The actual survey monument is not to be disturbed. If the existing survey monument damaged or destroyed, the contractor shall contact the Engineer and is responsible for installing a new monument, case, and cover. The monument’s case and cover shall be lowered prior to overlay. Install a new riser and adjust the case and cover to finished grade after the overlay. If a case and cover cannot be lowered, as determined by the Engineer, the contractor shall plane around the existing case and cover. Where the overlay will be placed on existing pavement without planing the contractor shall protect the existing case and cover and install new riser case and cover to finished grade. SECTION 8-13.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: 8-13.4 Measurement (Kent Special Provision) Measurement per each for “Install New Riser for Monument’s Case and Cover to Finished Grade” will be by the unit of each new monument’s riser installed. SECTION 8-13.5 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 125 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 8-13.5 Payment (Kent Special Provision) Payment will be made in accordance with Section 1-04.1, for the following bid items when they are included in the Proposal: The unit contract price per each for “Install New Riser for Monument’s Case and Cover to Finished Grade” constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to protect the existing monument and adjust the monument’s case and cover to finished grade with a new riser as shown on the plans and described in the specifications. This work includes but shall not be limited to: referencing for future locates prior to overlay, excavating, backfilling, compacting, surfacing and restoration. Any adjustments made prior to the final finished elevation shall be considered incidental to this bid item. Reference Kent Standard Plan 6-72aM and 6-72bM. 8-14 CEMENT CONCRETE SIDEWALKS SECTION 8-14.1 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-14.1 Description (Kent Special Provision) This work shall also consist of constructing sidewalk ramps at all street intersections, curb return driveways, or other locations in accordance with these specifications and in reasonable close conformity to the dimensions and cross- sections shown in the plans and to the lines and grades as staked by the Engineer. 8-14.3 Construction Requirements SECTION 8-14.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-14.3 Construction Requirements (Kent Special Provision) SECTION 8-14.3(3) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-14.3(3) Placing and Finishing Concrete (Kent Special Provision) The concrete shall be placed in the forms and struck off with an approved straightedge. As soon as the surface can be worked, it shall be troweled smooth with a steel trowel. 212th St. Preservation/Holcomb SP - 126 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 After trowling and before installing the contraction joints or perimeter edging, the walking surfaces of the sidewalk and ramps shall be brushed in a traverse direction with a stiff bristled broom. The curb face and top on the monolithic cement concrete curb and sidewalk and the cement concrete sidewalk with raised edge shall be smooth. Expansion and contraction joints shall be constructed as shown in the Standard plans. When the sidewalk abuts a cement concrete curb or curb and gutter, the expansion joints in the sidewalk shall have the same spacing as the curb. The expansion joint shall be filled to full cross-section of the sidewalk with 3/8-inch premolded joint filler. Sidewalk ramps shall be of the type specified in the plans. The detectable warning pattern shall have the truncated dome shape shown in the Standard Plans and may be formed by either embossing the wet concrete, adding a manufactured material after the concrete has cured, or installing masonry or ceramic tiles. When masonry or ceramic tiles are used, the Contractor shall block out the detectable warning pattern area to the depth required for installation of the tiles and finish the construction of the concrete ramp. After the concrete has set and the forms have been removed, the Contractor shall install the tiles using standard masonry practices. The two-foot wide detectable warning pattern area on the ramp shall be yellow and shall match the color of “Standard Interstate Yellow” paint as specified in Formula K-2-83. Yellow masonry paint for precast curbs, Formula H-3-83. SECTION 8-14.3(5) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-14.3(5) Detectable Warning Surface The following pertains only to Detectable warning surface (DWS), Detectable Directional Striping or truncated domes placed on existing surfaces. DWS and Detectable Directional Striping placed on asphalt or an existing surface including existing concrete ramps where specified on the plans shall be yellow, non-skid and vertical discontinuity caused may not exceed 0.25 inches. Thermoplastic or pre- formed will not be permitted. DWS shall be installed by a licensed or approved equal installer per the manufacturer’s specifications. The detectable warning surface used shall be placed at the back of curb and gutter (except in the mid- block crossing where it shall be in line with the front of the mountable curb) and shall be continuously 2’ wide along curb ramp radii with no gaps. Detectable Directional Striping shall be ADA compliant conforming to Title III Regulations, 28 CFR Part 36 ADA STANDARDS FOR ACCESSIBLE DESIGN, Appendix A, Section 4.29.2 DETECTABLE WARNINGS ON WALKING SURFACES and provide tactile directional guidance using a grooved/cane detectable surface. It shall be 6 inches wide, shall match the color of “Standard Interstate Yellow” paint as specified in Formula K-2-83 and shall be placed as shown on the plans at the back of curb behind the bike ramp and approaching the bike ramp. Acceptable products include but are not limited to: Vanguard GuideStrip Directional, ADA Solution, Inc Directional Bar Tile, Armor-Tile Detectable Directional, Access Tile Directional Wayfinding ADA Compliant Tiles. 212th St. Preservation/Holcomb SP - 127 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-14.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-14.4 Measurement (Kent Special Provision) “Detectable Directional Striping” shall be 12” wide and is measured per linear foot. SECTION 8-14.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-14.5 Payment (Kent Special Provision) Payment will be made in accordance with Section 1-04.1 for the following bid items when included in the Proposal: “Cement Concrete Sidewalk,” per square yard “Cement Concrete Sidewalk, 8 Inch Depth,” per square yard “Cement Concrete Sidewalk Ramp Type Parallel A,” per each The unit bid per square yard or per each for the above items constitutes complete compensation for all materials, labor, tools and equipment necessary to install cement concrete sidewalk and wheelchair ramps as shown on the drawings and in accordance with the Kent Special Provisions. The unit price shall include but not be limited to: restoration of areas adjacent to sidewalks and ramps that are disturbed from sidewalk forms; and all other materials, labor, tools and equipment to fulfill the requirements or as directed by the Engineer. Crushed Surfacing Top Course and Asphalt Concrete Pavement Patch, Excavation, Detectable Warning Surface and Gravel Borrow as required shall be paid for under separate bid items. “Detectable Warning Surface,” per square foot “Detectable Directional Striping,” per linear foot The unit bid for the above constitutes complete compensation for all materials, labor, tools and equipment necessary to supply and install the above per the manufacturers recommendation and in full compliance with ADA requirements. 8-20 ILLUMINATION, TRAFFIC SIGNAL SYSTEMS, INTELLIGENT TRANSPORTATION SYSTEMS, AND ELECTRICAL 8-20.3 Construction Requirements SECTION 8-20.3(5) IS REVISED AS FOLLOWS: (******) 8-20.3(5) Conduit (Kent Special Provision) THE SECOND PARAGRAPH IS REPLACED IN ITS ENTIRETY WITH THE FOLLOWING: 212th St. Preservation/Holcomb SP - 128 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The size of conduit used shall be that size shown in the plans and Kent Standard Plans. Conduits smaller than 2-inch electrical trade size shall not be used. No conduit run shall exceed 225 degree total bends in any run without prior approval of the Engineer. THE FOLLOWING PARAGRAPH IS ADDED AFTER THE SECOND PARAGRAPH: The Contractor shall install 1/4 inch diameter nylon pull rope in all conduit runs. A tracer wire terminating within junction boxes shall be installed in all conduits intended for future use. The tracer wire shall be uninsulated #8 AWG stranded copper. THE FOLLOWING CHANGES APPLY TO THE NUMBERED ITEMS FOLLOWING THE WORDS “Galvanized steel conduit shall be installed at the following locations:” Item 1. Change to read “All State highway roadbed crossings” Item 3. Contents are deleted, leaving it BLANK SECTION 8-20.3(6) IS SUPPLEMENTED BY ADDING THE FOLLOWING: 8-20.3(6) Junction Boxes, Cable Vaults, and Pull boxes (Kent Special Provision) Slip-resistant surfaces (non-skid) shall have a static coefficient of friction (COF) of 0.6 and WSDOT initial approval such as the Mebec1 (their most aggressive surface) manufactured by IKG Industries, SlipNOT Grade 3 – coarse manufactured by W.S. Molnar Company or the TH605 manufactured by Thermion, Inc. THE THIRD PARAGRAPH OF SECTION 8-20.3(8) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-20.3(8) Wiring (Kent Special Provision) All splices in underground illumination circuits and induction loops circuits shall be installed within junction boxes. The only splice allowed in induction loop circuits shall be the splice connecting the induction loop lead in conductors to the shielded home run cable. Splices for illumination circuits, including two way, three way, four way and aerial splices, and splices for induction loop circuits shall be spliced with copper crimped solder-less connectors installed with an approved tool designed for the purpose to securely join the wires both mechanically and electrically. Splices shall then be wrapped with moisture sealing tape meeting the requirements of Sections 9-29.12(1) and 9-29.12(2) of the Kent Special Provisions to seal each splice individually, unless otherwise specified by the Engineer. In no case shall epoxy splice kits be permitted. SECTION 8-20.3(14)C IS REVISED AS FOLLOWS: 212th St. Preservation/Holcomb SP - 129 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (******) 8-20.3(14)C Induction Loop Vehicle Detectors (Kent Special Provision) THE LAST SENTENCE IN ITEM 2 IS REVISED TO READ: Each additional loop installed in the lane shall be on 16 foot centers. ITEM 4 IS REVISED AS FOLLOWS: 4. All content after the first sentence is DELETED. ITEM 9 AND ITEM 10 CONTENTS ARE DELETED, LEAVING THEM BLANK SECTION 8-20.3(14)C IS SUPPLEMENTED BY ADDING THE FOLLOWING TO THE END OF THIS SECTION: Loop sealant shall be CrafcoTM Loop Detector Sealant 271, or approved equal. Installation shall conform to the manufacturer’s recommendations. SECTION 8-20.3(14)D IS REVISED AS FOLLOWS: (******) 8-20.3(14)D Test for Induction Loops and Lead-In Cable (Kent Special Provision) SPECIFIED TESTS ARE REVISED AS FOLLOWS: Test B – A megger test at 500 volts DC shall be made between the cable shield and grounding, prior to connection to grounding. The resistance shall equal or exceed 200 megohms. Test C – A megger test shall be made between the loop circuit and grounding. The resistance shall equal or exceed 200 megohms. SECTION 8-20.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-20.5 Payment (Kent Special Provision) “Non-skid Type 1 Junction Box Frame and Cover” “Non-skid Type 2 Junction Box Frame and Cover” “Non-skid Type 8 Junction Box Frame and Cover” The unit contract price per each for the above items constitutes complete compensation for furnishing all labor, materials, tools, supplies, and equipment necessary to remove and dispose of the existing frame and cover, install the new frame and cover as described above and adjust the specified structure to final 212th St. Preservation/Holcomb SP - 130 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 finished grade as shown on the plans and described in the specifications. This work includes but shall not be limited to: referencing for future locates, excavating, backfilling, compacting, surfacing and restoration. Adjusting the grade by adding or removing risers, rings, or sections as required will be included in this bid item. Any adjustments made prior to the final finished elevation shall be considered incidental. “6 Foot Diameter Traffic Loop” “Bicycle Detector Loops” The unit contract price per each for the items listed above constitutes complete compensation for all labor, materials, tools, supplies, and equipment necessary to provide and install a traffic loop to the size and location shown on the drawings and in accordance with the Kent Special Provisions and WSDOT Standard Specifications. The unit bid price shall include but not be limited to: saw cutting the pavement; the first 40 lineal feet of lead-in wire, sealing; connect new wiring to existing home run cable; testing and any additional labor, grinding to open and re-welding to close lids on junction boxes, materials, tools, supplies and equipment necessary for the satisfactory completion of said item. Bid item shall also include any sealing, and restoration needed for loop and wire installation. Reference Kent Standard Plans 6-98 and 6-99. The contract price shall also include equipment, tools, materials and labor necessary for the temporary operation of the existing traffic signal system during installation of the new system as well as removal and disposal/salvage of the existing traffic signal system. The unit contract price per each for “Stub-out to Existing Junction Box” constitutes complete compensation for all labor, materials, tools, supplies, and equipment necessary to install a junction box stub out for traffic loops per Kent Special Provisions and WSDOT Standard Specifications. The unit bid shall include but not be limited to: saw cutting the pavement; sand, crushed rock, conduit, testing and any additional labor, materials, tools, supplies and equipment necessary for the satisfactory completion of said item. Sidewalk and curb removal and replacement will be paid for under the corresponding bid items. Reference Kent Standard Plans 6-99. The unit contract price per lineal foot for “Additional Lead-In Wire” shall be complete compensation for all labor, materials, tools, supplies and equipment necessary to furnish and install the additional lead-in wire at the location shown on the plans and described in the specifications. The unit bid shall include but not be limited to: saw cutting the pavement; wiring; sealant; connect new wiring to existing home run wire in the existing junction box; testing and any additional labor, grinding to open and re-welding to close lids on junction boxes, materials, tools, supplies and equipment necessary for the satisfactory completion of said item. Bid item shall also include any sealing and restoration needed for loop and wire installation. Please note, this bid item will be paid based on the lineal footage of saw cutting, regardless of the lineal footage or number of lead-in wire. Measurement begins after the first 40’ of individual loop home run cable and saw cut or after two or more loop wire/cuts are combined together to form a lead in. The lump sum unit contract price for “Home Run Cable” shall be complete compensation for all labor, materials, tools, supplies and equipment necessary to 212th St. Preservation/Holcomb SP - 131 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 furnish and install the home run cable from the junction box to the controller cabinet as shown on the plans and specifications. This bid item does not include conduit as there is already existing conduit which will be utilized for the new loop connection. The unit contract price per each for “Pedestrian Pushbutton (PPB) Post” shall constitute complete compensation for all labor, tools, materials, supplies necessary to install a new APS pushbutton on a new accessible breakaway pedestrian pushbutton post with foundation as shown on the plans and WSDOT specifications. This bid item shall include but not be limited to: new concrete foundation, furnish and install new post, disassembly of the existing pedestrian pushbutton from the signal pole, installation of a new APS pushbuttons on the new post, covering the abandoned holes on the existing pole with sealed corrosion resistance cover, wiring, connection, conduits, fittings, testing, labor and industry inspection, and all other items required for a fully functional system. The unit contract price per each for “Pedestrian Pushbutton (APS)” shall constitute complete compensation for all labor, tools, materials, supplies necessary to remove and dispose of the existing pushbutton system and install a new APS pushbutton mounted in the same location as shown on the plans and WSDOT specifications. This bid item shall include but not be limited to: disassembly of the existing pedestrian pushbutton from the signal pole, installation of a new APS pushbuttons on the existing post or signal pole, covering the abandoned holes on the existing pole with sealed corrosion resistance cover, installation of pushbutton extension as shown on the plans per WSDOT detail IS-2, wiring, connection, conduits, fittings, testing, labor and industry inspection, and all other items required for a fully functional system. “Countdown LED Pedestrian Head (Type D Mount)” “Countdown LED Pedestrian Head (Type E Mount)” The unit contract price per each for the above items shall constitute complete compensation for all labor, tools, materials, supplies necessary to remove and dispose of the existing pedestrian signal head and install a new countdown LED pedestrian signal head as shown on the plans and WSDOT specifications. This bid item shall include but not be limited to: disassembly of the existing pedestrian head from the signal pole, installation of a new pedestrian signal head on the existing signal pole or post, covering the abandoned holes on the existing pole with sealed corrosion resistance cover, wiring, connection, conduits, fittings, testing, labor and industry inspection, and all other items required for a fully functional system. 8-21 PERMANENT SIGNING SECTION 8-21.2 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-21.2 Materials (Kent Special Provision) Sign posts shall be rolled carbon sheet steel, ASTM 1011 or ASTM A653 grade 50 and be hot dipped galvanized per AASHTO M-120 with minimum yield strength of 212th St. Preservation/Holcomb SP - 132 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 60,000 psi. Sign posts shall be 2” square with 7/16” diameter pre-punched holes on 1” center full length of the post on all sides. Post anchors shall be zinc hot dipped galvanized material meeting ASTM A500 grade B, 7 gauge. 2 ½” x 2 ½” square Telespar anchor or Engineer approved equivalent. Post anchor length shall be 30”. Post anchor shall have a 7/16” diameter hole on each side of the post located 2” from the top. SECTION 8-21.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-21.3 Construction Requirements (Kent Special Provision) All signs installed on project shall conform to Kent Standard Plan 6-82M. All sign post shall be installed on cement concrete foundation and post anchor. The concrete in the sign foundation shall be Commercial Concrete in accordance with the requirements of Section 6-02. Cement concrete foundation and post anchor shall be allowed to cure at least 24 hours prior to post and sign installation. The vertical distance from the bottom of the sign to the edge of traveled way shall not be less than 7 feet, except that the vertical distance from the bottom of W1-8 sign to the edge of traveled way shall be not less than 48 inches and not greater than 60 inches. The vertical distance from the bottom of the sign to the ground surface for D3 series signs shall not be less than 9 feet. SECTION 8-21.3(4) IS REVISED BY DELETING THE 4TH SENTENCE OF THE LAST PARAGRAPH AND ADDING THE FOLLOWING: (******) 8-21.3(4) Sign Removal (Kent Special Provision) Wood signs, wood sign posts, wood structures, metal sign posts, windbeams, other metal structural members, and all the existing fastening hardware connecting such members shall become the property of the Contractor and shall be removed from the project. Aluminum signs shall remain the property of the City. The Contractor shall bundle and band the signs, and deliver the signs to the Sign Shop at the City Maintenance Facility located at 5821 South 240th Street (a.k.a. West James Street). All signs shall be delivered to the Sign Shop prior to physical completion of the project. The Contractor shall be charged $2.00 per square foot for any signs that are lost or are rendered unusable as signs by the Contractor’s operation. All signs that are not designated for removal, but that are damaged by the Contractor’s operations shall be replaced, restored, or repaired at the Contractor’s sole expense. The Engineer’s determination regarding what replacement, restoration, or repair must be made by the Contractor to repair damage caused by the Contractor’s removal operations is final. 212th St. Preservation/Holcomb SP - 133 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 8-21.3(5) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-21.3(5) Sign Relocation (Kent Special Provision) Relocated signs shall be installed on new wood posts unless otherwise specified on the plans, or by the Engineer. SECTION 8-21.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-21.5 Payment (Kent Special Provision) The unit contract price per each for “Traffic Signs, Including Foundation” constitutes complete compensation for all labor, tools materials, supplies and equipment necessary to supply and install permanent signing shown on the plans and described in the specifications. This bid item includes but is not limited to: excavation, backfilling, concrete foundation, and supplying and installing the sign and sign post. The unit contract price per each for “Traffic Signs” constitutes complete compensation for all labor, tools, materials, supplies and equipment necessary to supply and install the permanent signing as specified on the plans and described in the specifications. The unit contract price per each for “Removal of Traffic Signs” constitutes complete compensation for all labor, materials, supplies and equipment necessary to remove, dispose, salvage, or deliver the traffic signs shown on the plans and described in the specifications. 8-22 PAVEMENT MARKING SECTION 8-22.1 IS REVISED AS FOLLOWS: SECTION 8.22.2 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-22.2 Materials (Kent Special Provision) Type A (Liquid Hot Applied Thermoplastic) plastic material shall be used when applying the following pavement markings. • Plastic Crosswalk Lines • Plastic Stop Lines Type B (Pre-Formed Fused Thermoplastic) plastic material shall be used when applying the following pavement markings. 212th St. Preservation/Holcomb SP - 134 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 • Plastic Speed Bump markings Type D (Liquid Cold Applied Methyl Methacrylate) plastic material shall be used when applying the following pavement markings. • Profiled Plastic lane lines • Plastic Flat long lines • Plastic Wide lane lines • Plastic Bike Lane Lines not applied in sidewalk • Profiled Plastic Double Yellow Centerlines • Profiled Plastic Two-Way Left Turn Lane Lines • Plastic Traffic Arrows • Plastic Traffic Letters • Plastic Railroad Crossing makings MMAX AREA MARKINGS WITH CORUNDUM (Type D - Liquid Cold Applied Methyl Methacrylate with Corundum) shall be used when applying the following pavement markings. • Single Solid Plastic Edge Line applied in sidewalk • Plastic Bike Lane Symbols • Plastic Green Bike Lane • Green bike crossing • All other pavement markings installed in sidewalks and pedestrian pathways for the purpose of directing cyclists. Painted striping and curbing paint shall be installed using Low VOC Solvent Based Paint meeting the requirements of Section 9-34. Type A plastic material shall be BC2000 series or approved equal meeting the requirements of Section 9-34 and the following requirements. Type A plastic materials shall be capable of being applied at a temperature between 375 °F to 450 °F (190 °C to 230 °C) and to the required thickness without excessive overspray, running or deformation of the edges. Type A plastic materials shall be capable of bearing traffic within 5 minutes after application, 10 minutes when pavement surface temperature is at or above 130 °F(54°C), and show no deformation or flaking at temperatures between –10 °F to 140 °F (–23 °C to 60 °C). The marking compound shall contain glass beads and shall have top dressing of glass beads applied. Type B plastic material shall have glass beads homogeneously blended throughout the material with a securely bonded protruding exposed layer of beads that provide immediate and required retroreflectivity. No additional glass beads shall be needed to be dropped on the material during application to obtain the required retroreflectivity. MMAX AREA MARKINGS WITH CORUNDUM shall meet the requirements of Section 8-22.3(A). No glass beads are required. Type D plastic material shall meet the requirements of Section 9-34. Glass beads shall be as recommended by the material manufacturer. Raised Pavement Markers shall meet the requirements of Section 8-09.2. 212th St. Preservation/Holcomb SP - 135 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 All materials shall be selected from material listed in the Washington State Department of Transportation qualified product list (QPL). SECTION 8.22.3 IS SUPPLEMENTED WITH THE FOLLOWING: (******) 8-22.3 Construction Requirements (Kent Special Provision) Profiled and Embossed plastic lines shall be constructed in accordance with the WSDOT Standard Plan M-20.20-02. Unless otherwise noted, pavement markings shall be installed in strict conformance to Kent Standard Plans 6- 74. (******) ADD NEW SECTION 8.22.3(A): 8-22.3(A) MMA AREA MARKINGS WITH CORUNDUM (Kent Special Provision) New Section MMAX AREA MARKINGS WITH CORUNDUM is designed to meet the non-slip requirements needed for cyclist and shall be mixed and installed in accordance with the Manufacturer’s specifications conforming to the following requirements: Materials used to create MMAX AREA MARKINGS WITH CORUNDUM shall consist of MMAX AREA MARKING Pre-pigmented Methyl Methacrylate Resin, MMAX AREA MARKING hardwearing aggregate and catalyst. MMAX AREA MARKING’s will have the following performance properties: Density 18.5 +/- 0.5 Lbs. / Gallon Solids >99% ASTM D2205 Build Thickness 90 +/- 10 Mils VOC <100 Grams/Liter Pot Life ~15min AASHTO T237 Skid >60 ASTM E303 Hardness 50-60 ASTM D2240 Water Absorption <0.25% ASTM D570 Keep materials in dry, protected areas, between 40°F to 80°F. Keep out of direct sunlight and protected from open flame. Finished Color: E-F Bike Lake Green or White as specified in the contract plans. Methyl Methacrylate Resin: Methyl Methacrylate resin shall have the following properties:. Density 12.8 +/- 0.35 Lbs/Gal Tensile >2000 psi ASTM D638 Elongation >70% ASTM D638 Flash Point >50°F / 10°C ASTM D1310 212th St. Preservation/Holcomb SP - 136 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Resin must be supplied in compliant metal pails that have UN1A2Y1.9/100 rating. Aggregate: Hardwearing Aggregate shall be provided by the manufacturer and will have a hardness of 9 on the Mohs scale. Aggregate shall be a neutral, light color that will not affect the color of the finished product, and will have a mesh sizing of 24 Grit. Aggregate must be supplied in 25.5 +/- lbs. (11.7 +/- 0.23kg) pre-packaged bags or pails. Catalyst: Catalyst shall come in a powder form and be supplied in bulk at the maximum usage rate of 0.51 +/-0.2 lbs (0.23 +/- 0.09 kg) per mixed pail of resin and aggregate. Application: Ambient and surface temperature for installation shall be between 40-100°F, and should be 5°F above the dew point temperature with less than 75% relative humidity. Clean the intended application area thoroughly. All loose particles, dirt, sand dust, etc. must be removed. Broom and use a power blower or compressed air. The surface must be clean, dry and free of all dust, oil, debris and any other material that might interfere with the bond between marking and the surface to be treated. All concrete curing compounds shall be completely removed from concrete surfaces prior to installation by shot blasting or grinding. Existing concrete surfaces shall be wire brushed, but may require shot blasting or grinding dependent on condition.’ Clean areas containing chemical contaminants such as vehicle fluids, using a degreasing solution, and ensure removal of contaminants and degreasing solution well in advance of the application. Existing pavement markings that are to be left in place, utilities, drainage structures, curbs and any other structure within or adjacent to the treatment location shall be masked to protect from application. Existing pavement markings conflicting with the surface treatment must be removed by grinding or water blasting. Extra care must be taken to thoroughly remove the dust and debris caused from grinding. Installed pavement marking must be 100% cured, which will be a hardened solid state, before opening the marked area to traffic. SECTION 8-22.3(1) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-22.3(1) Preliminary Spotting (Kent Special Provision) 212th St. Preservation/Holcomb SP - 137 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 The Contractor shall use existing curb, gutter, and/or sidewalk as control to assist in preliminary spotting of the lines before beginning the placement of pavement markings. The Contractor shall be responsible for preliminary spotting of the lines to be marked and verification that minimum lane widths will result from the application. Preliminary spotting to guide the placement of longitudinal lines is required. Preliminary spotting for each lane lines shall be provided at transition points as required by Kent Standard Plan 6-74. Approval by the Engineer is required before the placement of permanent pavement marking. SECTION 8-22.3(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING PARAGRAPH TO THE END OF THIS SECTION: (******) 8-22.3(2) Preparation of Roadway Surfaces (Kent Special Provision) The preparation of roadway surfaces related to the installation of RPMs shall meet the requirements of Section 8-09.3(1). SECTION 8-22.3(3) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.3(3) Marking Application (Kent Special Provision) The Contractor is responsible for providing traffic control and traffic control devices as necessary to direct vehicular traffic away from freshly painted traffic stripes until such time as the marking paint has completely dried. Failure to ensure reasonable protection for the undried paint stripes will result in the Engineer’s decision to adjust the method of payment for damaged paint stripes. The Engineer’s decision regarding the means of payment adjustment for vehicle damaged paint stripes is final in this matter. Type 2 markers may be warmed prior to setting by heating to a maximum temperature of 120 F for a maximum of 10 minutes. The second coat of yellow paint applied to concrete curbs shall have glass beads applied at the rate of 12 pounds per 100 linear feet of curbing. SECTION 8-22.3(3)B IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.3(3)B Line Patterns (Kent Special Provision) 212th St. Preservation/Holcomb SP - 138 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Double Solid Yellow Center Line - Two solid yellow lines, each 4 inches wide, separated by a 4-inch space. Single Solid Yellow Center Line - One solid yellow line, 4 inches wide, to delineate adjacent curb, barrier, etc. at select locations. Skip Center Line - A broken yellow line 4 inches wide. The broken pattern shall be based on a 40-foot unit consisting of a 10-foot line and a 30-foot gap. Skip center stripe may be used as centerline delineation on select two way highways and streets. Two Way Left Turn Line (TWLTL) - A solid yellow line, 4 inches wide, with a broken yellow line 4 inches wide, separated by a 4-inch space. The broken pattern shall be based on a 40-foot unit consisting of a 10-foot line and a 30-foot gap. The solid line shall be installed to the right of the broken line relative to the direction of travel and for each direction of travel. Skip Lane Line - A broken white line 4 inches wide to delineate adjacent lanes traveling in the same direction. The broken pattern shall be based on a 40-foot unit consisting of a 10-foot line and a 30-foot gap. Gore / Wide Lane Line - A solid white line 8 inches wide used for delineation at ramp connections, to separate left and right turning movements from through movements, to separate high Occupancy Vehicle (HOV) lanes from general purpose lanes, for traffic islands, hash marks, chevrons, and other applications. Wide Dotted Line - A broken white or yellow line, 8 inches wide, matching color with its associated solid or broken line. The dotted pattern shall be based on an 8- foot unit consisting of a 2-foot line and a 6-foot gap. Dotted Line - A broken white or yellow line, 4 inches wide, matching color with its associated solid or broken line, an extension of an edge line, lane line, or centerline used at exit ramps, intersections, horizontal curves, multiple turn lanes, and other locations where the direction of travel for through traffic is unclear. The dotted pattern shall be based on a 6-foot unit consisting of a 2-foot line and a 4-foot gap. Edge Line / Solid Lane Line - A single solid white line 4 inches wide used for road edge and lane delineation, bike lane delineation, adjacent lanes traveling in the same direction or bus pull-outs. Crosswalk Stripe A series of pairs of parallel SOLID WHITE lines, 8-feet long as shown in Kent Standard Plan 6-75. SECTION 8-22.3(5) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.3(5) Installation Instructions (Kent Special Provision) 212th St. Preservation/Holcomb SP - 139 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 RPMs shall be installed per the requirements of Section 8-09.3(4). SECTION 8-22.3(6) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.3(6) Removal of Pavement Markings (Kent Special Provision) Where required for the construction of the project or where directed by the Engineer, the Contractor shall remove pavement markings. The pavement marking shall be obliterated until blemishes caused by the pavement marking removal conform to the coloration of the adjacent pavement. Painting is not an acceptable method for obliteration or removal of pavement markings. Only hydroblasting equipment will be allowed for the removal of pavement markings. Vacuum shrouded equipment, or other equally effective means, shall be used to contain and collect all debris and excess water. Collected water and debris shall be disposed of off the project site in accordance with Department of Ecology or other federal, state or local regulations. The removal of raised pavement markers shall be incidental to the removal of the associated marking. Where the project involves overlay or pavement, paint stripes do not have to be obliterated unless specifically called for on the Project Plans, or Traffic Control Plans. All plastic letters, plastic arrows, plastic stripes of all types, plastic buttons, and plastic lane markers shall be removed prior to any overlay of pavement or where the roadway is being rechannelized or where specified on the Plans. Also see Section 8-09.3(1) of the Kent Special Provisions. The City has not shown the type of existing pavement markings on the plans. The bidder shall visit the site to determine the extent, location and type of items to be removed. SECTION 8-22.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.4 Measurement (Kent Special Provision) “Profiled Plastic Skip Lane Line” “Profiled Plastic Wide Line” “Single Solid Plastic Edge Line” The measurement for the above items will be based on the total length of each plastic line installed. No deduction will be made for the unmarked area when the marking includes a broken line such as, wide broken lane line, drop lane line, or wide dotted lane line. The measurement for double wide lane line will be based on the total length of each wide lane line installed. The measurement for “Profiled Plastic Two Way Left Turn Line” and “Profiled Plastic Double Yellow Center Line” will be based on the total length of each 4 inch wide 212th St. Preservation/Holcomb SP - 140 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 plastic line installed. No deduction will be made for the unmarked area when the marking includes a broken line such as, center line, dotted line, dotted extension line, center line with no-pass line, lane line, reversible lane line, or two-way left- turn center line. Double yellow and two way left turn markings shall be measured by the completed linear foot and will not be counted for each individual line which composes the line pattern. The measurement for “Plastic Bicycle Lane Symbol” shall include both the bike rider symbol and bike lane arrow as one per each measurement as shown on the WSDOT Standard Plan M-9.50. The measurement for “Plastic Green Bike Lane” shall be per square foot of green marking applied. The 6” white line shown on the bicycle pedestrian crosswalk detail shall be incidental to this bid item. The measurement for “Plastic Bicycle Detector Pavement Marking” shall include both the bike rider symbol and vertical line segments above and below the symbol as one per each measurement as shown in the MUTCD Figure 9C-7. SECTION 8-22.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 8-22.5 Payment (Kent Special Provision) “Profiled Plastic Double Yellow Center Line,” per linear foot “Profiled Plastic Skip Lane Line,” per linear foot “Profiled Plastic Two Way Left Turn Line,” per linear foot “Profiled Plastic Wide Line,” per linear foot “Single Solid Plastic Edge Line,” per linear foot “Plastic Stop Line, 24 Inch Wide,” per linear foot “Plastic Green Bike Lane,” per square foot “Plastic Bicycle Detector Pavement Marking, ” per each The lump sum unit contract price for “Referencing Existing Pavement Markings” shall be full compensation for all work required to referencing and document all existing pavement markings as described in Section 1-05.18. . 8-23 TEMPORARY PAVEMENT MARKINGS THE FIRST PARAGRAPH OF SECTION 8-23.1 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 8-23.1 Description (Kent Special Provision) The work shall consist of furnishing, installing and removing temporary pavement markings. Temporary pavement markings shall be provided where noted in the 212th St. Preservation/Holcomb SP - 141 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 plans and for all lane shifts and detours resulting from construction activities. Temporary pavement markings shall also be provided when permanent markings are eliminated because of construction operations. Temporary pavement markings shall be maintained in serviceable condition throughout the project until permanent markings are installed. Temporary pavement markings that are damaged shall be repaired or replaced immediately. Edge lines shall be installed unless otherwise specified in the Contract. DIVISION 8 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTIONS: 8-28 POTHOLE UTILITIES (******) 8-28.1 Description (Kent Special Provision) New Section This work shall consist of potholing utilities at the locations shown on the plans and described in the specifications. The Contractor shall notify the Engineer, a minimum of 24 hours before the pothole work is performed, (******) 8-28.2 Materials (Kent Special Provision) New Section Backfill and surfacing material shall match conditions of pothole location. Pothole work located in asphalt concrete pavement, shall be backfilled with gravel borrow and crushed rock, then patched with asphalt cold mix. Pothole work located in cement concrete shall be backfilled with gravel borrow, then patched with cement concrete. Pothole work not on paved surfaces shall be backfilled with native material. (******) 8-28.3 Construction Requirements (Kent Special Provision) New Section The pothole shall be of sufficient size and depth to expose existing utilities to determine potential conflicts and verify compatibility with designs. Excavation; hauling, dewatering; backfill, compaction, surface restoration, and cleanup are included with this work. (******) 8-28.4 Measurement (Kent Special Provision) New Section Pothole utilities shall be measured per pothole work performed. (******) 212th St. Preservation/Holcomb SP - 142 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 8-28.5 Payment (Kent Special Provision) New Section Payment will be made in accordance with Section 1-04.1, for the following bid items when they are included in the Proposal: The contract price per each for “Pothole Utilities” constitutes complete compensation for all labor, materials, tools, supplies, and equipment necessary to pothole utilities at the locations shown on the plans and described in the specifications. 8-30 PROJECT SIGNS (******) 8-30.1 Description (Kent Special Provision) New Section This work shall consist of fabrication of the project signs; furnishing and installing all posts, braces, and hardware and installation and maintenance of the project signs where shown in the plans or where directed by the Engineer. All project signs become the property of the City at the end of the project and shall be delivered by the Contractor to the City Maintenance Shop on West James Street. (******) 8-30.2 Materials (Kent Special Provision) New Section Sign posts shall be 4 inch x 6 inch Fir. (******) 8-30.3 Construction Requirements 8-30.3(1) Erection of Posts (Kent Special Provision) New Section All posts shall be set reasonably vertical, and deep enough to sustain sign and expected wind loads as determined by the Engineer. (******) 8-30.3(2) Design A (Kent Special Provision) New Section Three (3) vertical 4 inch x 4 inch Fir posts shall be attached to the sign board. Three horizontal 2 inch x 4 inch Fir braces shall be attached to the back of the sign board, one each on the top, the bottom, and in the middle. Attachment of posts and bracing shall meet with the approval of the Engineer. 212th St. Preservation/Holcomb SP - 143 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (******) 8-30.3 Installation (Kent Special Provision) New Section Fasten two (2) vertical 4 inch x 6 inch Fir posts evenly spaced at the back of the sign board. Posts shall be of break-away design with no more than 12.25 square inches of drilled shear area at a point 2 inches above the ground, or as directed by the Engineer. Attachment of posts and bracing shall meet with the approval of the Engineer. (******) 8-30.4 Measurement (Kent Special Provision) New Section Project signs will be measured by the installed and maintained unit. Failure of the Contractor to adequately maintain the project signs—as determined by the Engineer—shall be deemed noncompliance with this Specification. (******) 8-30.5 Payment (Kent Special Provision) New Section Payment will be made in accordance with Section 1-04.1, for the following bid item when included in the Proposal: The unit contract price per each for “Project Sign” constitutes complete compensation for furnishing all labor, tools, supplies, equipment and materials, to fabricate, install, and maintain the project sign for the life of the project and removal and delivery of sign back to the City Shops. Failure to adequately maintain and return project signs to the City Maintenance Shop shall be deemed reasonable grounds for the Engineer to adjust the payment made under this bid item. Said adjustment shall be determined solely by the Engineer and is not negotiable except at the Engineer’s discretion. 212th St. Preservation/Holcomb SP - 144 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 DIVISION 9 – MATERIALS 9-02 BITUMINOUS MATERIALS 9-02.1 Asphalt Material, General (******) 9-02.1(4) Performance Graded Asphalt Binder (PGAB) (Kent Special Provision) SECTION 9-02.1(4) IS REVISED BY DELETING AND REPLACING WITH THE FOLLOWING: This section’s title is revised to read: Performance Graded (PG) Asphalt Binder The first paragraph is revised to read: PG asphalt binder meeting the requirements of AASHTO M 332 Table 1 of the grades specified in the Contract shall be used in the production of HMA. For HMA with greater than 20 percent RAP by total weight of HMA, or any amount of RAS, the new asphalt binder, recycling agent and recovered asphalt (RAP and/or RAS) when blended in the proportions of the mix design shall meet the PG asphalt binder requirements of AASHTO M 332 Table 1 for the grade of asphalt binder specified by the Contract. The second paragraph, including the table, is revised to read: In addition to AASHTO M 332 Table 1 specification requirements, PG asphalt binders shall meet the following requirements: Additional Requirements by Performance Grade (PG) Asphalt Binders Property Test Method PG58S- 22 PG58H- 22 PG58V- 22 PG64S-28 PG64H- 28 PG64V- 28 RTFO Residue : Average Percent Recover y @ 3.2 kPa AASHTO T 3501 30% Min. 20% Min. 25% Min. 30% Min. 1Specimen conditioned in accordance with AASHTO T 240 – RTFO. The third paragraph is revised to read: The RTFO Jnrdiff and the PAV direct tension specifications of AASHTO M 332 are not required. This section is supplemented with the following: 212th St. Preservation/Holcomb SP - 145 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 If the asphalt binder verification sample test results fail to meet AASHTO Test Method T 350 “Standard Method of Test for Multiple Stress Creep Recovery (MSCR) Test of Asphalt Binder Using a Dynamic Shear Rheometer (DSR)” for average percent recovery @ 3.2 kPa for the applicable grades of binder in accordance with Section 9-02.1(4), the Contracting Agency may elect to test the sample using AASHTO Test Method T 301 “Standard Method of Test for Elastic Recovery Test of Asphalt Materials by Means of a Ductilometer.” When AASHTO T 301 is used, a minimum of 65% elastic recovery (ER) will be required when tested at 25°C ± 0.5°C. 9-03 AGGREGATES 9-03.12 Gravel Backfill SECTION 9-03.12(3) IS REVISED BY DELETING THE GRAVEL SPECIFICATION AND REPLACING IT WITH THE FOLLOWING: (******) 9-03.12(3) Gravel Backfill for Pipe Zone Bedding (Kent Special Provision) Pipe bedding shall be 5/8 inch minus crushed rock. Pea gravel is not allowed. All material shall conform with the following gradation: Sieve Size Passing 3/4 Inch 100% 5/8 Inch 95 - 100% 1/4 Inch 45 - 65% US No. 40 6 - 18% US No. 200 7.5 max. % % Fracture 75 min. Sand Equivalent 40 min. L.A. wear 500 rev. 35 percent max., degradation 25 percent min. Free from wood waste, bark and other deleterious material. 9-03.14 Borrow SECTION 9-03.14(1) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 9-03.14(1) Gravel Borrow (Kent Special Provision) Gravel Borrow material shall consist of pit-run granular material conforming to the following gradation: 212th St. Preservation/Holcomb SP - 146 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Sieve Size Percent Passing 3 Inch* 100 3/4 Inch 65 - 100 U.S. No. 4 25 - 70 U.S. No. 10 10 - 50 U.S. No. 40 0- 30 U.S. No. 200 0 - 5 Sand equivalent 50 min. The maximum passing the U.S. No. 200 sieve is limited to five percent (5%) based on the minus #4 inch fraction. Sieve analysis shall be used to verify that this requirement is met. Recycled materials such as broken concrete or asphalt, shall not be allowed unless specifically authorized in advance by the Engineer. Where additional materials are required to formulate the street sub-base to the cross section denoted in the plans, said additional material shall be Gravel Borrow. * The maximum size of stone for geosynthetic reinforced walls or slopes shall be 100 percent passing 1 1/4 inch square sieve and 90 to 100 percent passing 1 inch square sieve. All other sieve values continue to apply. SECTION 9-03.17 IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 9-03.17 Foundation Material Class I and Class II (Kent Special Provision) Foundation Material Class I and Class II shall be used to replace unsuitable material removed from unstable pipe trench bottoms. Foundation Material Class I and Class II shall conform to the following gradations: Percent Passing Sieve Size Class I Class II 6” square 100 --- 4” square --- 100 2” square 0 65-85 1” square --- 40-70 1/4” square --- 20 max All percentages are by weight. In addition, all rock shall be sound, angular ledge rock or recycled cement concrete pavement meeting the following specifications. Suppliers of recycled cement concrete products shall have a quality assurance program reviewed and approved by the City. Each rock or piece of recycled cement concrete pavement shall have at least two fractured faces. 212th St. Preservation/Holcomb SP - 147 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Adsorption 3% max (Corps of Engineers CRD-C-107) Accelerated Expansion (15) days 15% max Soundness 5% max loss Density (solid volume) 155 pcf min Specific Gravity 2.48 min 9-03.21 Recycled Material SECTION 9-03.21(1)D IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-03.21(1)D Recycle Glass (glass cullet) (Kent Special Provision) Steel Furnace Slag shall not be used for any purposes. 9-13 RIPRAP, QUARRY SPALLS, SLOPE PROTECTION, AND ROCK FOR EROSION AND SCOUR PROTECTION AND ROCK WALLS SECTION 9-13 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 9-13.8 Rock for Ditches (Kent Special Provision) New Section Rocks for ditches shall meet the following requirements for grading: Sieve Size Percent Passing 12” 95 to 100 6” 40 to 60 3” 10 to 20 3/4” 0 to 5 9-14 EROSION CONTROL AND ROADSIDE PLANTING 9-14.1 Topsoil SECTION 9-14.1(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-14.1(1) Topsoil Type A (Kent Special Provision) 212th St. Preservation/Holcomb SP - 148 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Topsoil Type A (Compost Amended Planting Soil) shall consist of 50 – 67% sand and/or sandy loam and 33 – 50% composted organic material by volume. Total organic matter shall be at least 5% by dry weight for areas where turf will be installed, and at least 10% by dry weight for all other landscape areas. Organic matter shall be determined by Loss-on-Ignition test. Acceptable tests include the most current version of ASTM D2974 “Test Methods for Moisture, Ash, and Organic Matter of Peat and Other Organic Soils,” and TMECC 05.07A “Loss-On-Ignition Organic Matter Method.” Compost-Amended Planting soil shall not contain any viable seeds or roots capable of sprouting any State-listed noxious weed, or invasive root-propagating plants including but not limited to horsetail, ivy, clematis, knotweed, Scot’s broom, reed canary grass, Himalayan blackberry, etc. Soil found to contain these prohibited viable plant materials shall be removed and replaced at the Contractor’s expense. A. The soil shall meet the following requirements. 1. The mixed soil shall meet the following gradation: Screen Size * Percent Passing 2 inch 100 1 inch 99-100 5/8” 90 – 100 1/4" 75-100 *Maximum particle length of 6 inches B. Shall have a pH range between 5.5 and 8.5. The pH shall be determined by soil test. C. Organic material shall consist of composted yard debris or organic waste material composted for a minimum of 3 months. Compost shall consist of 100% recycled content and meet all requirements for compost in section 9- 14.4(8) of the Standard Specifications. D. Submit a certified laboratory analysis from an accredited soils testing laboratory indicating the Material source and compliance with all planting soil and compost specifications to the Engineer or project Ecologist for approval no less than seven (7) days before delivery to the Project Site. The analysis shall be with a sample size of no less than 2 pounds. E. Site specific soil testing (after placement of material) may be required for projects requiring more than 50 cubic yards of compost-amended planting soil A Contractor provided accredited laboratory approved by the Engineer shall make recommendations for amendments required for optimum growth at no cost to the owner. The Contractor will be allowed five (5) Working Days to complete the testing from the time of written notice given by the Engineer. F. A sample of the compost amended planting soil shall be provided to the Engineer or project Ecologist in a 1-gallon re-closable bag at least seven (7) days prior to application. 212th St. Preservation/Holcomb SP - 149 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 9-14.2 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 9-14.2(4) Sandy Loam (Kent Special Provision) Sandy loam shall consist of soil having a maximum clay content of ten percent by weight. In addition, soil particles shall meet the following requirements for grading: Passing 1 inch sieve (square opening) ................... 100% Passing 1 mm sieve ........................................... 80% minimum Passing 0.15 mm sieve ....................................... 15% maximum SECTION 9-14.3 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-14.3 Seed (Kent Special Provision) Hydroseed: Seed shall be “Blue Tag” or certified quality. The Contractor shall deliver in unopened containers with mixture seed content and inert material content plainly marked on the outside of the container. Grasses used shall meet the following specifications: Mix A (Roadside and Erosion Control Grass): Weight Proportion Seed Mix “A” Ingredient Min. % Pure Seed Min. % Germination Max. % Weed Seed 40% Perennial Ryegrass 98% 90% 0.5% 40% Creeping Red Fescue 98% 85% 0.5% 10% Colonial Bentgrass 98% 90% 0.5% 10% White Dutch Clover (Pre-inoculated) 98% 90% 0.5% The Contractor shall submit to the Engineer the manufacturer's Certificate of Conformance for seed. A complete analysis of the seed shall be submitted to the City for approval including percent of pure seed, germination, other crop seed, inert and weed and the germination test date. The City reserves the right to reject any or all plant material at any time until final inspection or acceptance. The Contractor shall remove rejected plants immediately from site. The Contractor shall produce upon request sales receipt for all nursery stock and certificates of inspection. 212th St. Preservation/Holcomb SP - 150 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 9-14.4 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-14.4 Fertilizer (Special Provisoin) Fertilizer for trees: Fertilizer shall consist of slow-release commercial fertilizer (6- 10-8). Fertilizer for upland seeded areas: Lilly Miller or approved equal to provide the following nutrients: All areas which are seeded shall receive fertilizer of the following proportions and formulation: Total available Nitrogen ............................. 16% of weight (of which 50% is derived from ureaform) Total available Phosphorous ....................... 16% of weight Total available Potassium ........................... 16% of weight Fertilizer for wetland seeded areas: All areas which are seeded in wetlands or in detention ponds shall receive fertilizer of the following proportions and formulation: Total available nitrogen ............................. 21% (Analyzed as N) Available phosphorous ............................... 0% (Analyzed as P205) Available potassium ................................ 10% (Analyzed as K20) Above percentages are proportioned by weight. The Contractor shall deliver fertilizer to the site in original unopened containers bearing manufacturer's chemical analysis, name, trade name, trade mark, and indication of conformance to state and federal laws. Instead of containers, fertilizer may be furnished in bulk with certificate indicating the above information. 9-14.5 Mulch and Amendments SECTION 9-14.5(8) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-14.5(8) Compost (Kent Special Provision) Compost shall not contain any sawdust, straw, green or under-composed organic matter, under-sterilized manure or toxic or otherwise harmful materials. SECTION 9-14.5 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 212th St. Preservation/Holcomb SP - 151 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 9-14.5(10) Wood Cellulose Fiber (Kent Special Provision) New Section Wood cellulose mulch shall be specially processed 100 percent virgin wood fiber containing no growth or germination-inhibiting ingredients. It shall be manufactured in such a manner that after addition and agitation in slurry tanks with water, the fibers in the material will become uniformly suspended to form a homogenous slurry. When hydraulically sprayed on the ground, the material shall allow the absorption and percolation of moisture. Wood cellulose fiber shall be Weyerhaeuser Silva-Fiber Plus w/Tackifier or approved equal. Organic matter content shall be at least 93 percent on an oven-dry basis as determined by ASTM D 586. The moisture content shall be no more than 15 percent as determined by oven dried weight. Each package of the cellulose fiber shall be marked by the manufacturer to show the dried weight content. 9-28 SIGNING MATERIALS AND FABRICATION SECTION 9-28.1 IS REVISED BY DELETING THE THIRD PARAGRAPH AND INSERTING THE FOLLOWING: (******) 9-28.1 General (Kent Special Provision) All signs, except for City Project Signs, shall be constructed with retroreflective sheeting according to the following: • All D series, E series, G series, I series, L series, M series, P series, R series, K series, and W series signs shall be constructed entirely of Type III or Type IV (HIP) reflective sheeting. • All S series signs shall be constructed entirely of Type XI (3M Diamond Grade DG3 or Avery Dennison OmniCube) reflective sheeting. Legends for STOP and YIELD signs may be constructed using screen processing in accordance to the sheething manufacturer. Legends of all other signs must be constructed with 3M Electrocut firm and shall be manufactured in strict conformance with Kent Standard Plan 6-82aM. Sign legends include borders, letters, numerals, symbols, shields, and arrows. Reflective legend sheething types shall not be mixed on individual signs. Standard control signs and guide sign borders, letters, numerals, symbols, shields, and arrows shall be in accordance with the WSDOT Sign Fabrication Manual M 55-05. For non-standard signs not found in the WSDOT Sign Fabrication Manual, the Contractor shall provide fabrication details for approval prior to sign fabrication. 212th St. Preservation/Holcomb SP - 152 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 9-28.8 IS REVISED BY DELETING THE SHEET THICKNESS TABLE IN THE SECOND PARAGRAPH AND REPLACING WITH THE FOLLOWING: (******) 9-28.8 Sheet Aluminum Signs (Kent Special Provision) Maximum Horizontal Dimension Sheet Aluminum Thickness 30 inches and under 0.080 inch Over 30 inches 0.125 inch SECTION 9-28.12 IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-28.12 Reflective Sheeting (Kent Special Provision) Type XI Retroreflective Element Material Obs. Angle Entrance Angle White Yellow Orange Green Red Blue Brown Florescent Yellow- Green Florescent Yellow Florescent Orange 0.1° B -4° 830 620 290 83 125 37 25 660 500 250 0.1° B +30° 325 245 115 33 50 15 10 260 200 110 0.2° -4° 580 435 200 58 87 26 17 460 350 175 0.2° +30° 220 165 77 22 33 10 7.0 180 130 66 0.5° -4° 420 315 150 42 63 19 13 340 250 125 0.5° +30° 150 110 53 15 23 7.0 5.0 120 90 45 1.0° -4° 120 90 42 12 18 5.0 4.0 96 72 36 1.0° +30° 45 34 16 5.0 7.0 2.0 1.0 36 27 14 9-28.14 Sign Support Structures SECTION 9-28.14(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-28.14(2) Steel Structures and Posts (Kent Special Provision) Truss chords, struts, and diagonals, end posts, and end post struts and diagonals for sign bridge structures and cantilever sign structures shall conform to either ASTM A 36 or ASTM A 53 Grade B Type E or S. The nominal pipe diameter and the pipe wall thickness shall be as specified in the plans or Standard Plans. All other structural steel for sign bridge structures and cantilever sign structures shall conform to ASTM A 36. Truss member connection hardware shall conform to Section 9-06.5(3). Pipe members for bridge mounted sign brackets shall conform to ASTM A 53 Grade B Type E or S, and shall be Schedule 40 unless otherwise specified. All other structural steel for bridge mounted sign brackets shall conform to ASTM A 36. U bolts, and associated nuts and washers, shall be stainless steel conforming to Section 9-28.11, and shall be fabricated hot. 212th St. Preservation/Holcomb SP - 153 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 Anchor rods, nuts and washers for sign bridge structure foundations shall conform to Section 9-06.5(4). Anchor rods for cantilever sign structure foundations shall conform to ASTM F 1554 Grade 104, including the appropriate supplemental requirements for grade and manufacturer’s identification, and charpy impact testing (15 foot-pounds minimum at 40F). Nuts and washers for cantilever sign structure foundations shall conform to AASHTO M 291 Grade DH and AASHTO M 293, respectively. Anchor rods for sign bridge structures and cantilever sign structures shall be galvanized after fabrication a minimum of 1’-0” at the exposed end in accordance with AASHTO M 232. Anchor rod templates shall conform to ASTM A 36, but need not be galvanized. Steel sign structures and posts shall be galvanized after fabrication in accordance with AASHTO M 111, unless noted otherwise in the plans. All bolts, nuts, and washers shall be galvanized after fabrication in accordance with AASHTO M 232. Unless otherwise specified in the plans or Kent Special Provisions, metal surfaces shall not be painted. Minor fabricating and modifications necessary for galvanizing will be allowed if not detrimental to the end product as determined by the Engineer. If such modifications are contemplated, the Contractor shall submit to the Engineer, for approval six copies of the proposed modifications, prior to fabrication. Sign posts shall be Telespar or Engineer approved equal. Sign posts shall be rolled carbon sheet steel, ASTM 1011 or ASTM A653 grade 50 and be hot dipped galvanized per AASHTO M-120 with minimum yield strength of 60,000 psi. Sign post shall be 2” square with 7/16” diameter pre-punched holes on 1” center full length of the post on all sides. Post anchors shall be Telespar anchor or Engineer approved equal. Post anchor shall be zinc hot dipped galvanized material meeting ASTM A500 grade B, 7 guage. 2 ½” x 2 ½” square. Post anchor length shall be 30”. Post anchor shall have a 7/16” diameter hole on each side of the post located 2” from the top. 9-29 ILLUMINATION, SIGNAL, ELECTRICAL SECTION 9-29.18 IS SUPPLEMENTED BY ADDING THE FOLLOWING NEW SECTION: (******) 9-29.18(3) Video Detection System (Kent Special Provision) The video detection camera housing and mounting hardware shall be painted per Section 6-07 of these Special Provisions. The fully functional video detection systems shall be provided and installed by the Contractor. The Contractor shall submit complete equipment list to the Engineer for approval prior to the systems purchase. The video detection system shall be capable of providing presence vehicle detection and shall be expandable without removing or replacing existing units. All materials furnished during construction for temporary and permanent 212th St. Preservation/Holcomb SP - 154 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 detection shall be new, unused, current production models and shall be items currently in distribution. The video detection system shall have a minimum 18- month warranty (from the time of permanent installation) against manufacturing defects in materials and workmanship from the date of shipment. The Contractor shall supply the warranty and all documentation necessary to maintain and operate the system to the Engineer prior to approval of the video detection system by the Engineer. The Video Detection System shall consist of ITERIS video detection equipment, auxiliary equipment, cameras, housings, and mounts, and all required mounting hardware, cables, connectors, and wiring. The video detection equipment shall be of the quantities shown on the Plans, and shall meet the following specifications (The contractor shall submit to the Engineer a detailed summary of video detection equipment prior to placing an order): Camera Vantage Vector RZ-4 Advanced WDR color camera with integrated weatherproof housing or Vantage Vector with video and radar sensor fusion. Mounting Pelco Astro-Brac Extended Tilt & Pan mount with cable mount and 72 inch tube. The cable mount shall be suitable for the mast arm diameter at the camera installation location. The camera shall be mounted on the mast arm per manufacturer’s recommendation. Wiring Siamese Belden 8281 Video Detection Board Vantage Edge 2 — Dual Camera Processor Remote Monitoring Vantage View (include 9” LCD color monitor at each signal and non rack mounted design. Modem Edge Connect Network Modem Surge Suppression Each camera assembly shall have a surge suppressor which shall be installed inside the traffic signal controller cabinet. The surge suppressor shall be an EDCO CXO6- BNCY or equivalent meeting these specifications: Peak Surge Current 5Ka Technology Hybrid, Solid State Attenuation 0.1dB @ 10 Mhz Response Time < 1 nanosecond Protection Line to Ground Clamp Voltage 6V Connectors BNC 212th St. Preservation/Holcomb SP - 155 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 9-30 WATER DISTRIBUTION MATERIALS 9-30.1 Pipe SECTION 9-30.1(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-30.1(1) Ductile Iron Pipe (Kent Special Provision) Pipe for water mains shall be cement mortar lined ductile iron Class 52 and conforming to the latest revisions to the ANSI specifications. Connections shall be mechanical or push-on joint with rubber gaskets unless otherwise specified on the plans. 9-30.2 Fittings SECTION 9-30.2(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-30.2(1) Ductile Iron Pipe (Kent Special Provision) Cast or ductile iron pipe fittings shall have the same coating, lining and strength as the pipes to which they are connected. Fittings shall be flanged or mechanical joint. Mechanical joint fitting gaskets shall be vulcanized styrene butadiene rubber gaskets (SBR) in accordance with the most current version of AWWA standard C111/A21.11. Flanged joint fitting gaskets shall be full face synthetic rubber gaskets appropriate to meet the required pressure rating in accordance with the most current version of AWWA standard C115/A21.15. 12-inch diameter water main shall be Restrained Joint Ductile Iron Pipes (RJ) as shown on the plans. 1. Restrained Joint Ductile Iron Pipe shall meet the following requirements: a. The pipe joint restraint system shall meet the restrained joint requirements described in KSP 9-30.2(6); b. The Minimum Radius of Curvature shall be: i. 150 LF for 12-inch diameter pipe ii. 174 LF for 16-inch diameter pipe c. Full length and custom cut (field cut) pipe shall have the same slip- out (pull-out) resistance as described in KSP 9-30.2(6); d. Field welds are not allowed; all retainer weldments shall be shop fabricated at the pipe manufacturer’s factory or a pipe manufacturer approved welding shop. SECTION 9-30.1(2) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 156 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 9-30.1(2) Polyethylene Encasement (Kent Special Provision) Polyethylene encasement shall be 8 mil thick polyethylene encasement that mitigates microbiologically influenced corrosion and controls galvanic corrosion. SECTION 9-30.2(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: 9-30.3 Valves Fittings for 12-inch and larger diameter water pipes that connect to restrained joint pipe shall meet the restrained joint requirements described in KSP 9-30.2(6). SECTION 9-30.2(6) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 9-30.2(6) Restrained Joints (Kent Special Provision) Restrained joints for 12-inch and larger diameter water mains shall meet the following requirements (except where 12-inch or larger diameter flanged fitting connections are shown on the plans): 1. Restrained joints shall be gasketed push-on joints; 2. Gaskets shall be vulcanized styrene butadiene rubber gaskets (SBR) in accordance with the most current version of AWWA standard C111/A21.11 and shall meet the pipe manufacturer’s written recommendations and requirements; 3. Gasket lubrication shall be in accordance with the most current version of AWWA standard C111/A21.11, shall meet the pipe manufacturer’s written recommendations and requirements, and shall allow pipe deflection, expansion, and contraction throughout the life of the pipe; 4. Minimum allowable deflection at each joint shall be: a. 4° for 12-inch diameter pipe b. 3° for 16-inch diameter pipe 5. Minimum slip-out (pull-out) resistance shall be: a. 204,000 lbf (pound-force) for 12-inch diameter pipe b. 272,000 lbf (pound-force) for 16-inch diameter pipe 6. Restrained joints shall have a metal to metal contact locking system without the use of gripping teeth; 7. Joint restraint shall be accomplished by inserting components to provide positive axial lock between the bell interior surface and a retainer weldment (weld bead) on the spigot end of the pipe. 9-30.3 Valves SECTION 9-30.3(1) IS SUPPLEMENTED BY ADDING THE FOLLOWING: (******) 212th St. Preservation/Holcomb SP - 157 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 9-30.3(1) Gate Valves (3 to 16 Inches) (Kent Special Provision) Gate valves shall be resilient wedge gate type as manufactured by Clow, American Darling, Waterous, Dresser M&H, Mueller or an approved equal, with epoxy-coated valve interiors. They shall conform to AWWA specifications C-509, and shall have a working pressure rating of 250 psi, unless otherwise specified in the Kent Special Provisions. They shall be iron bodied bronze mounted, non-rising stem, and counterclockwise opening. Valve stems shall be provided with O-ring seals. SECTION 9-30.3(4) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 9-30.3(4) Valve Boxes (Kent Special Provision) Valve boxes shall be installed on all buried valves and conform to Kent Standard Plan 3-7. The box shall be of cast iron, 2-piece design with a base corresponding to the size of the valve and the top section. The box shall be coal-tar painted by the manufacturer using industry standards. The valve box top section shall be an Olympic Foundry No. 940. The cover shall be an Olympic Foundry deep skirt No. 940 DS, have the word “WATER” cast into it, and shall be of the non-locking type, unless a locking cover is specifically called for in the Kent Special Provisions or shown on the plans. The bottom section shall be an Olympic VB-1C or approved equal. A 3 feet x 3 feet x 6 inches concrete pad, flush with finish grade, shall be poured around each valve box top section not located within asphalt or concrete finished areas. Valve box covers shall have the lugs or stainless cap screws installed parallel to the direction of water flow. SECTION 9-30.3(5) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 9-30.3(5) Valve Marker Posts (Kent Special Provision) Valve marker posts shall be constructed of Class 3000 cement concrete; shall be 4- inches by 4-inches by 42-inches long with a 6-1/4 inch by 4-inch base; shall contain one number 3 reinforcement bar; and shall otherwise conform to Kent Standard Plan 3-4. The exposed portion of the marker posts shall be coated with two coats of WHITE concrete paint. The FOG-TITE valve marker post is the pre-approved marker post. 212th St. Preservation/Holcomb SP - 158 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SECTION 9-30.3(6) IS DELETED AND REPLACED WITH THE FOLLOWING: (******) 9-30.3(6) Valve Stem Extensions (Kent Special Provision) Valve stem extensions shall conform to Kent Standard Plan 3-7. Valve stem operating nuts shall be no shallower than one and one-half (1 1/2) feet. Valves with an operating nut more than 3 feet below finished grade shall have a solid steel valve stem extension rod assembly, with a rock guard, installed on the operating nut. 9-34 PAVEMENT MARKING MATERIALS (******) IN THE THIRD PARAGRAPH, THE TABLE TITLED “METAL CONCENTRATION LIMITS” IN SECTION 9-34.4 IS REVISED WITH THE FOLLOWING: (Kent Special Provision) Metal Concentration Limits Element Test Method Max. Parts Per Million (ppm) Arsenic EPA 3052 SW-846 6010C 10.0 Barium EPA 3052 SW-846 6010C 100.0 Cadmium EPA 3052 SW-846 6010C 1.0 Chromium EPA 3052 SW-846 6010C 5.0 Lead EPA 3052 SW-846 6010C 50.0 Silver EPA 3052 SW-846 6010C 5.0 Mercury EPA 3052 SW-846 7471B 4.0 212th St. Preservation/Holcomb SP - 159 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 (September 30, 2020) Standard Plans The State of Washington Standard Plans for Road, Bridge and Municipal Construction M21-01 effective September 30, 2020, is made a part of this contract. The Standard Plans are revised as follows: A-50.10 DELETED A-50.20 DELETED A-50.30 DELETED A-50.40 DELETED B-90.40 Valve Detail – DELETED C-1a DELETED C-8 Add new Note 5, “5. Type 2 Barrier and Barrier Terminals are allowed in temporary installations only. New Type 2 Barrier and Barrier Terminals are not allowed to be fabricated after December 31, 2019. The plan is provided as a means to verify that any Type 2 barrier and Barrier Terminals fabricated prior to December 31, 2019 meets the plan requirements and cross-sectional dimensions as specified in Standard Specifications 6-10.3(5). C-8a Add new Note 2, “2. Type 4 Barrier and Barrier Transition are allowed in temporary installations only. New Type 4 Barrier and Barrier Transition are not allowed to be fabricated after December 31, 2019. The plan is provided as a means to verify that any Type 4 barrier and Barrier Transition fabricated prior to December 31, 2019 meets the plan requirements and cross-sectional dimensions as specified in Standard Specifications 6-10.3(5).” C-8b DELETED C-8e DELETED C-16a DELETED 212th St. Preservation/Holcomb SP - 160 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 C-20.10 The following table is added: SLOPE\EMBANKMENT TABLE (FOR 8’, 9’, 11’ LONG POSTS) POST LENGTH SLOPE W (FT) 8-FOOT 1H : 1V OR FLATTER 2.5 MIN 8-FOOT 2H : 1v OR FLATTER 0 (FACE OF BARRIER AT SLOPE BREAK POINT) 9-FOOT 1.5H : 1V OR FLATTER 0 (FACE OF BARRIER AT SLOPE BREAK POINT) 11-FOOT 1H : 1V OR FLATTER 0 (FACE OF BARRIER AT SLOPE BREAK POINT) C-20.11 DELETED C-20.19 DELETE C-40.16 DELETED C-40.18 DELETED C-80.50 DELETED C-85.14 DELETED D-2.14 DELETED D-2.16 DELETED D-2.18 DELETED D-2.20 DELETED D-2.42 DELETED D-2.44 DELETED D-2.46 DELETED 212th St. Preservation/Holcomb SP - 161 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 D-2.48 DELETED D-2.82 DELETED D-2.86 DELETED D-10.10 Wall Type 1 may be used if no traffic barrier is attached on top of the wall. Walls with traffic barriers attached on top of the wall are considered non-standard and shall be designed in accordance with the current WSDOT Bridge Design Manual (BDM) and the revisions stated in the 11/3/15 Bridge Design memorandum. D-10.15 Wall Type 2 may be used if no traffic barrier is attached on top of the wall. Walls with traffic barriers attached on top of the wall are considered non-standard and shall be designed in accordance with the current WSDOT BDM and the revisions stated in the 11/3/15 Bridge Design memorandum. D-10.30 Wall Type 5 may be used in all cases. D-10.35 Wall Type 6 may be used in all cases. D-10.40 Wall Type 7 may be used if no traffic barrier is attached on top of the wall. Walls with traffic barriers attached on top of the wall are considered non-standard and shall be designed in accordance with the current WSDOT BDM and the revisions stated in the 11/3/15 Bridge Design memorandum. D-10.45 Wall Type 8 may be used if no traffic barrier is attached on top of the wall. Walls with traffic barriers attached on top of the wall are considered non-standard and shall be designed in accordance with the current WSDOT BDM and the revisions stated in the revisions stated in the 11/3/15 Bridge Design memorandum. D-15.10 STD Plans D-15 series “Traffic Barrier Details for Reinforced Concrete Retaining Walls” are withdrawn. Special designs in accordance with the current WSDOT BDM are required in place of these STD Plans. D-15.20 STD Plans D-15 series “Traffic Barrier Details for Reinforced Concrete Retaining Walls” are withdrawn. Special designs in accordance with the current WSDOT BDM are required in place of these STD Plans. D-15.30 212th St. Preservation/Holcomb SP - 162 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 STD Plans D-15 series “Traffic Barrier Details for Reinforced Concrete Retaining Walls” are withdrawn. Special designs in accordance with the current WSDOT BDM are required in place of these STD Plans. G-20.10 SIGN INSTALLATION BEHIND TRAFFIC BARRIER detail, dimension callout “3’ MIN.”, is revised to read “5’ MIN.”. H-70.20 Sheet 2, Spacing Detail, Mailbox Support Type 1, reference to Standard Plan I- 70.10 is revised to H-70.10 H-70.30 DELETED J-20.26 Add Note 1, “1. One accessible pedestrian pushbutton station per pedestrian pushbutton post.” J-20.16 View A, callout, was – LOCK NIPPLE, is revised to read; CHASE NIPPLE J-21.10 Sheet 1, Elevation View, Round Concrete Foundation Detail, callout – “ANCHOR BOLTS ~ ¾” (IN) x 30” (IN) FULL THREAD ~ THREE REQ’D. PER ASSEMBLY” IS REVISED TO READ: “ANCHOR BOLTS ~ ¾” (IN) x 30” (IN) FULL THREAD ~ FOUR REQ’D. PER ASSEMBLY” Sheet 1 of 2, Elevation view (Round), add dimension depicting the distance from the top of the foundation to find 2 #4 reinforcing bar shown, to read; 3” CLR.. Delete “(TYP.)” from the 2 ½” CLR. dimension, depicting the distance from the bottom of the foundation to find 2 # 4 reinf. Bar. Sheet 1 of 2, Elevation view (Square), add dimension depicting the distance from the top of the foundation to find 1 #4 reinforcing bar shown, to read; 3” CLR. Delete “(TYP.)” from the 2 ½” CLR. dimension, depicting the distance from the bottom of the foundation to find 1 # 4 reinf. Bar. Sheet 2 of 2, Elevation view (Round), add dimension depicting the distance from the top of the foundation to find 2 #4 reinforcing bar shown, to read; 3” CLR. Delete “(TYP.)” from the 2 ½” CLR. dimension, depicting the distance from the bottom of the foundation to find 2 # 4 reinf. Bar. Sheet 2 of 2, Elevation view (Square), add dimension depicting the distance from the top of the foundation to find 1 #4 reinforcing bar shown, to read; 3” CLR. Delete “(TYP.)” from the 2 ½” CLR. dimension, depicting the distance from the bottom of the foundation to find 1 # 4 reinf. Bar. Detail F, callout, “Heavy Hex Clamping Bolt (TYP.) ~ 3/4” (IN) Diam. Torque Clamping Bolts (see Note 3)” is revised to read; “Heavy Hex Clamping Bolt (TYP.) ~ 3/4” (IN) Diam. Torque Clamping Bolts (see Note 1)” Detail F, callout, “3/4” (IN) x 2’ – 6” Anchor Bolt (TYP.) ~ Four Required (See Note 4)” is revised to read; “3/4” (IN) x 2’ – 6” Anchor Bolt (TYP.) ~ Three Required (See Note 2)” 212th St. Preservation/Holcomb SP - 163 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 J-21.15 Partial View, callout, was – LOCK NIPPLE ~ 1 ½” DIAM., is revised to read; CHASE NIPPLE ~ 1 ½” (IN) DIAM. J-21.16 Detail A, callout, was – LOCKNIPPLE, is revised to read; CHASE NIPPLE J-22.15 Ramp Meter Signal Standard, elevation, dimension 4’ - 6” is revised to read; 6’-0” (2x) Detail A, callout, was – LOCK NIPPLE ~ 1 ½” DIAM. is revised to read; CHASE NIPPLE ~ 1 ½” (IN) DIAM. J-40.10 Sheet 2 of 2, Detail F, callout, “12 – 13 x 1 ½” S.S. PENTA HEAD BOLT AND 12” S. S. FLAT WASHER” is revised to read; “12 – 13 x 1 ½” S.S. PENTA HEAD BOLT AND 1/2” (IN) S. S. FLAT WASHER” J-75.20 Key Notes, note 16, second bullet point, was: “1/2” (IN) x 0.45” (IN) Stainless Steel Bands”, add the following to the end of the note: “Alternate: Stainless steel cable with stainless steel ends, nuts, bolts, and washers may be used in place of stainless steel bands and associated hardware.” J-81.10 All references to “Type 170 Controller” are replaced with “Controller”. L-40.10 DELETED The following are the Standard Plan numbers applicable at the time this project was advertised. The date shown with each plan number is the publication approval date shown in the lower right-hand corner of that plan. Standard Plans showing different dates shall not be used in this contract. A-10.10-00 ....... 8/7/07 A-30.35-00 ....... 10/12/07 A-60.10-03 ........ 12/23/14 A-10.20-00 ....... 10/5/07 A-40.00-00 ...... 8/11/09 A-60.20-03 ........ 12/23/14 A-10.30-00 ....... 10/5/07 A-40.10-04 ...... 7/31/19 A-60.30-01 ........ 6/28/18 A-20.10-00 ....... 8/31/07 A-40.15-00 ...... 8/11/09 A-60.40-00 ........ 8/31/07 A-30.10-00 ....... 11/8/07 A-40.20-04 ...... 1/18/17 A-30.30-01 ....... 6/16/11 A-40.50-02 ...... 12/23/14 B-5.20-03 ......... 9/9/20 B-5.40-02 ......... 1/26/17 B-30.50-03 ...... 2/27/18 B-30.60-00 ...... 9/9/20 B-75.50-01 ........ 6/10/08 B-5.60-02 ......... 1/26/17 B-30.70-04 ...... 2/27/18 B-75.60-00 ........ 6/8/06 B-10.20-02 ....... 3/2/18 B-30.80-01 ...... 2/27/18 B-80.20-00 ........ 6/8/06 B-10.40-01 ....... 1/26/17 B-30.90-02 ...... 1/26/17 B-80.40-00 ........ 6/1/06 B-10.70-01 ....... 9/9/20 B-35.20-00 ...... 6/8/06 B-85.10-01 ........ 6/10/08 B-15.20-01 ....... 2/7/12 B-35.40-00 ...... 6/8/06 B-82.20-00 ........ 6/1/06 B-15.40-01 ....... 2/7/12 B-40.20-00 ...... 6/1/06 B-85.30-00 ........ 6/1/06 B-15.60-02 ....... 1/26/17 B-40.40-02 ...... 1/26/17 B-85.40-00 ........ 6/8/06 B-20.20-02 ....... 3/16/12 B-45.20-01 ...... 7/11/17 B-85.50-01 ........ 6/10/08 B-20.40-04 ....... 2/27/18 B-45.40-01 ...... 7/21/17 B-90.10-00 ........ 6/8/06 B-20.60-03 ....... 3/15/12 B-50.20-00 ...... 6/1/06 B-90.20-00 ........ 6/8/06 B-25.20-02 ....... 2/27/18 B-55.20-02 ...... 2/27/18 B-90.30-00 ........ 6/8/06 212th St. Preservation/Holcomb SP - 164 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 B-25.60-02 ....... 2/27/18 B-60.20-02 ...... 9/9/20 B-90.40-01 ........ 1/26/17 B-30.05-00 ....... 9/9/20 B-60.40-01 ...... 2/27/18 B-90.50-00 ........ 6/8/06 B-30.10-03 ....... 2/27/18 B-65.20-01 ...... 4/26/12 B-95.20-01 ........ 2/3/09 B-30.15-00 ....... 2/27/18 B-65.40-00 ...... 6/1/06 B-95.40-01 ........ 6/28/18 B-30.20-04 ....... 2/27/18 B-70.20-00 ...... 6/1/06 B-30.30-03 ....... 2/27/18 B-70.60-01 ...... 1/26/17 B-30.40-03 ....... 2/27/18 C-1 .................. 9/9/20 C-20.42-05 ...... 7/14/15 C-70.10-02 ........ 9/16/20 C-1b ............... 9/9/20 C-20.45.02 ...... 8/12/19 C-75.10-02 ........ 9/16/20 C-1d ............... 10/31/03 C-22.16-07 ...... 9/16/20 C-75.20-02 ........ 9/16/20 C-2c ................ 8/12/19 C-22.40-08 ...... 9/16/20 C-75.30-02 ........ 9/16/20 C-4f ................ 8/12/19 C-22.45-05 ...... 9/16/20 C-80.10-02 ........ 9/16/20 C-6a ............... 10/14/09 C-23.60-04 ...... 7/21/17 C-80.20-01 ........ 6/11/14 C-7 ................. 6/16/11 C-24.10-02 ...... 8/12/19 C-80.30-01 ........ 6/11/14 C-7a ............... 6/16/11 C-25.20-06 ...... 7/14/15 C-80.40-01 ........ 6/11/14 C-8 ................. 2/10/09 C-25.22-05 ...... 7/14/15 C-85.10-00 ........ 4/8/12 C-8a ............... 7/25/97 C-25.26-04 ...... 8/12/19 C-85.11-01 ........ 9/1620 C-20.10-06 ...... 9/16/20 C-25.30-00 ...... 6/28/18 C-85.15-01 ........ 6/30/14 C-20.14-04 ...... 8/12/19 C-25.80-05 ...... 8/12/19 C-85.16-01 ........ 6/17/14 C-20.15-02 ...... 6/11/14 C-60.10-01 ...... 9/24/20 C-85-18-01 ....... 6/11/14 C-20.18-03 ...... 8/12/19 C-60.20-00 ...... 9/24/20 C-85.20-01 ........ 6/11/14 C-20.40-07 ...... 8/12/19 C-60.30-00 ...... 9/24/20 C-20.41-02 ...... 8/12/19 C-60.70-00 ...... 9/24/20 D-2.04-00 ........ 11/10/05 D-2.80-00 ....... 11/10/05 D-6 .................. 6/19/98 D-2.06-01 ........ 1/6/09 D-2.84-00 ....... 11/10/05 D-10.10-01 ....... 12/2/08 D-2.08-00 ........ 11/10/05 D-2.88-00 ....... 11/10/05 D-10.15-01 ....... 12/2/08 D-2.32-00 ........ 11/10/05 D-2.92-00 ....... 11/10/05 D-10.20-01 ....... 8/7/19 D-2.34-01 ........ 1/6/09 D-3.09-00 ....... 5/17/12 D-10.25-01 ....... 8/7/19 D-2.36-03 ........ 6/11/14 D-3.10-01 ....... 5/29/13 D-10.30-00 ....... 7/8/08 D-2.60-00 ........ 11/10/05 D-3.11-03 ....... 6/11/14 D-10.35-00 ....... 7/8/08 D-2.62-00 ........ 11/10/05 D-3.15-02 ....... 6/10/13 D-10.40-01 ....... 12/2/08 D-2.66-00 ........ 11/10/05 D-3.17-02 ......... 5/9/16 D-10.45-01 ....... 12/2/08 D-2.68-00 ........ 11/10/05 D-4 ................... 12/11/98 E-1 ................. 2/21/07 E-4 ................. 8/27/03 E-2 ................. 5/29/98 E-4a ............... 8/27/03 F-10.12-04 ...... 9/24/20 F-10.62-02 ...... 4/22/14 F-40.15-04 ........ 9/25/20 F-10.16-00 ...... 12/20/06 F-10.64-03 ...... 4/22/14 F-40.16-03 ........ 6/29/16 F-10.18-02 ...... 9/24/20 F-30.10-04 ...... 9/25/20 F-45.10-02 ........ 7/15/16 F-10.40-04 ...... 9/24/20 F-40.12-03 ...... 6/29/16 F-80.10-04 ........ 7/15/16 F-10.42-00 ...... 1/23/07 F-40.14-03 ...... 6/29/16 G-10.10-00 ...... 9/20/07 G-25.10-05 ...... 9/16/20 G-95.10-02 ....... 6/28/18 G-20.10-02 ...... 6/23/15 G-26.10-00 ...... 7/31/19 G-95.20-03 ....... 6/28/18 G-22.10-04 ...... 6/28/18 G-30.10-04 ...... 6/23/15 G-95.30-03 ....... 6/28/18 G-24.10-00 ...... 11/8/07 G-50.10-03 ...... 6/28/18 G-24.20-01 ...... 2/7/12 G-90.10-03 ...... 7/11/17 G-24.30-02 ...... 6/28/18 G-90.11-00 ...... 4/28/16 G-24.40-07 ...... 6/28/18 G-90.20-05 ...... 7/11/17 G-24.50-05 ...... 8/17/19 G-90.30-04 ...... 7/11/17 G-24.60-05 ...... 6/28/18 G-90.40-02 ...... 4/28/16 H-10.10-00 ...... 7/3/08 H-32.10-00 ...... 9/20/07 H-70.10-01 ....... 2/7/12 H-10.15-00 ...... 7/3/08 H-60.10-01 ...... 7/3/08 H-70.20-01 ....... 2/16/12 H-30.10-00 ...... 10/12/07 H-60.20-01 ...... 7/3/08 I-10.10-01 ....... 8/11/09 I-30.20-00 ....... 9/20/07 I-40.20-00 ........ 9/20/07 I-30.10-02 ....... 3/22/13 I-30.30-02 ....... 6/12/19 I-50.20-01 ........ 6/10/13 I-30.15-02 ....... 3/22/13 I-30.40-02 ....... 6/12/19 I-60.10-01 ........ 6/10/13 I-30.16-01 ....... 7/11/19 I-30.60-02 ....... 6/12/19 I-60.20-01 ........ 6/10/13 I-30.17-01 ....... 6/12/19 I-40.10-00 ....... 9/20/07 I-80.10-02 ........ 7/15/16 212th St. Preservation/Holcomb SP - 165 March 22, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 J-10 ................ 7/18/97 J-28.40-02 ...... 6/11/14 J-60.13-00 ........ 6/16/10 J-10.10-04 ....... 9/16/20 J-28.42-01 ...... 6/11/14 J-60.14-01 ........ 7/31/19 J-10.12-00 ....... 9/16/20 J-28.43-01 ...... 6/28/18 J-75.10-02 ........ 7/10/15 J-10.14-00 ....... 9/16/20 J-28.45-03 ...... 7/21/16 J-75.20-01 ........ 7/10/15 J-10.15-01 ....... 6/11/14 J-28.50-03 ...... 7/21/16 J-75.30-02 ........ 7/10/15 J-10.16-01 ....... 9/16/20 J-28.60-02 ...... 7/21/16 J-75.40-02 ........ 6/1/16 J-10.17-01 ....... 9/16/20 J-28.70-03 ...... 7/21/17 J-75.41-01 ........ 6/29/16 J-10.18-01 ....... 9/16/20 J-29.10-01 ...... 7/21/16 J-75.45-02 ........ 6/1/16 J-10.20-03 ....... 9/16/20 J-29.15-01 ...... 7/21/16 J-80.10-00 ........ 6/28/18 J-10.21-01 ....... 9/16/20 J-29.16-02 ...... 7/21/16 J-80.15-00 ........ 6/28/18 J-10.22-01 ....... 9/16/20 J-30.10-00 ...... 6/18/15 J-81.10-01 ........ 9/16/20 J-10.25-00 ....... 7/11/17 J-40.05-00 ...... 7/21/16 J-86.10-00 ........ 6/28/18 J-12.15-00 ....... 6/28/18 J-40.10-04 ...... 4/28/16 J-90.10-03 ........ 6/28/18 J-12.16-00 ....... 6/28/18 J-40.20-03 ...... 4/28/16 J-90.20-03 ........ 6/28/18 J-15.10-01 ....... 6/11/14 J-40.30-04 ...... 4/28/16 J-90-21-02 ........ 6/28/18 J-15.15-02 ....... 7/10/15 J-40.35-01 ...... 5/29/13 J-90.50-00 ........ 6/28/18 J-20.10-04 ....... 7/31/19 J-40.36-02 ...... 7/21/17 J-20.11-03 ....... 7/31/19 J-40.37-02 ...... 7/21/17 J-20.15-03 ....... 6/30/14 J-40.38-01 ...... 5/20/13 J-20.16-02 ....... 6/30/14 J-40.39-00 ...... 5/20/13 J-20.20-02 ....... 5/20/13 J-40.40-02 ...... 7/31/19 J-20.26-01 ....... 7/12/12 J-45.36-00 ...... 7/21/17 J-21.10-04 ....... 6/30/14 J-50.05-00 ...... 7/21/17 J-21.15-01 ....... 6/10/13 J-50.10-01 ...... 7/31/19 J-21.16-01 ....... 6/10/13 J-50.11-02 ...... 7/31/19 J-21.17-01 ....... 6/10/13 J-21.20-01 ....... 6/10/13 J-50.12-02 ...... 8/7/19 J-50.13-00 ...... 8/22/19 J-26.15-01 ....... 5/17/12 J-50.15-01 ...... 7/21/17 J-27.10-01 ....... 7/21/16 J-50.18-00 ...... 8/7/19 J-27.15-00 ....... 3/15/12 J-50.19-00 ...... 8/7/19 J-28.10-02 ....... 8/7/19 J-50.20-00 ...... 6/3/11 J-28.22-00 ....... 8/07/07 J-50.25-00 ...... 6/3/11 J-28.24-02 ....... 9/16/20 J-50.30-00 ...... 6/3/11 J-28.26-01 ....... 12/02/08 J-60.05-01 ...... 7/21/16 J-28.30-03 ....... 6/11/14 J-60.11-00 ...... 5/20/13 K-70.20-01 ...... 6/1/16 J-60.12-00 ...... 5/20/13 K-80.10-01 ...... 6/1/16 K-80.20-00 ...... 12/20/06 K-80.35-00 ...... 2/21/07 K-80.37-00 ...... 2/21/07 L-10.10-02 ...... 6/21/12 L-70.10-01 ........ 5/21/08 L-20.10-03 ...... 7/14/15 L-40.15-01 ...... 6/16/11 L-70.20-01 ........ 5/21/08 L-30.10-02 ...... 6/11/14 L-40.20-02 ...... 6/21/12 M-1.20-04 ....... 9/25/20 M-11.10-03 ......8/7/19 M-40.20-00 ....... 10/12/07 M-1.40-03 ....... 9/25/20 M-12.10-02 ..... 9/25/20 M-40.30-01 ....... 7/11/17 M-1.60-03 ....... 9/25/20 M-15.10-01 ..... 2/6/07 M-40.40-00 ....... 9/20/07 M-1.80-03 ....... 6/3/11 M-17.10-02 ..... 7/3/08 M-40.50-00 ....... 9/20/07 M-2.20-03 ....... 7/10/15 M-20.10-03 ..... 9/25/20 M-40.60-00 ....... 9/20/07 M-2.21-00 ....... 7/10/15 M-20.20-02 ..... 4/20/15 M-60.10-01 ....... 6/3/11 M-3.10-04 ....... 9/25/20 M-20.30-04 ..... 2/29/16 M-60.20-02 ....... 6/27/11 M-3.20-03 ....... 9/25/20 M-20.40-03 ..... 6/24/14 M-65.10-02 ....... 5/11/11 M-3.30-04 ....... 9/25/20 M-20.50-02 ..... 6/3/11 M-80.10-01 ....... 6/3/11 M-3.40-04 ....... 9/25/20 M-24.20-02 ..... 4/20/15 M-80.20-00 ....... 6/10/08 M-3.50-03 ....... 9/25/20 M-24.40-02 ..... 4/20/15 M-80.30-00 ....... 6/10/08 M-5.10-03 ....... 9/25/20 M-24.60-04 ..... 6/24/14 M-7.50-01 ....... 1/30/07 M-24.65-00 ..... 7/11/17 M-9.50-02 ....... 6/24/14 M-24.66-00 ..... 7/11/17 M-9.60-00 ....... 2/10/09 M-40.10-03 ..... 6/24/14 212th St. Preservation/Holcomb A - 1 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 KENT STANDARD PLANS The following Kent Standard Plans supplement all other plans, which have been prepared for this project and are considered to be a part of the project plans. WATER 3-7 Valve Box and Operating Nut Extender STREET 6-33 Cement Concrete Curbs 6-34 Curb and Sidewalk Joint Example 6-35 Expansion and Contraction/Control Joints 6-38 Curb Ramp Locations 6-44 Industrial Cement Concrete Driveway Approach Depressed Sidewalk 6-72a Standard Monument, Monument Case, Cover and Riser 6-72b Alternate Diameter Monument Case Riser 6-74 Typical Lane Markings 6-75 Thermoplastic Crosswalk Markings 6-76 Plastic Arrows, Stop Bars & Only Legend 6-78 Railroad Warning Pavement Markings 6-79 Typical Pavement Markings 6-81 Left Turn Pocket at End of Two Way Left Turn Lane Layout 6-82a Sign Post Installation Type A 6-82b Sign Post Base Plate Installation Type B 6-93 Junction Boxes 6-97 Traffic Signal Controller Cabinet Base 6-98 Induction Loop Details 6-99 Induction Loop Installation Notes NUT OPERATING NUT EXTENDER VALVE BOX WITH OPERATING NUT EXTENDERLENGTHSTEEL ROD. 3/4" SOLID 1/8" MIN. THICK ROCK GUARD, 4 1/4" DIA.3.0' MAX.3'x3'x4" THICK CONCRETE (3,000 PSI) PAD AROUND VALVE COVER IN UNPAVED AREASVARIES; 3'-6" MIN.3'PLAN VIEW OPERATING 2" SQUARE 3' 4" NOTES: NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST.AS NEEDED1.EXTENSIONS ARE REQUIRED WHEN VALVE NUT IS MORE THAN THREE (3) FEET BELOW FINISHED GRADE. 2.EXTENSIONS SHALL BE SIZED AS NEEDED, AND PAINTED WITH TWO (2) COATS OF METAL PAINT. 3.EARS, LUGS OR STAINLESS CAP SCREWS (TRANSMISSION MAINS ONLY) ON COVER SHALL BE ALIGNED WITH DIRECTION OF WATER FLOW, SEE PLAN VIEW. 4.FOR ADDITIONAL REQUIREMENTS AND USE SEE CITY OF KENT DESIGN AND CONSTRUCTION STANDARDS 3.19.B AND C. 5.VALVE BOX SHALL BE CENTERED OVER 2" SQUARE OPERATING NUT. OPERATING NUT EXTENDER AS NEEDED (BELOW RIGHT) C/L SEE NOTE 3 WATER MAIN DIRECTION WATER SLOPE AWAY 2% MAX (TYP)2%MAXOLYMPIC FOUNDRY VB 940 WITH TWO (2) INCH "DEEP SKIRT" COVER. THE COVER SHALL BE MARKED "WATER". SEE NOTES 3, 4, AND 5. CARE SHALL BE TAKEN IN BACKFILL OPERATIONS ENSURING OPERATING NUT IS IN CENTER AT ALL TIMES BASE SECTION: RICH 24" VALVE BOX BOTTOM, OLYMPIC NO. VB1C OR PRE-APPROVED EQUAL AND SHALL BE COMPATIBLE WITH TOP SECTION COMBINED CURB AND GUTTER1/2"R12"6"5 1/2" 6"12" 1 " R 1 " R 1"6"12" 24"12"3 1/2"2"10"4"6 1/2"CURB TRANSITION NOTES: 1.CONCRETE CLASS 3000. TYPICAL, UNLESS WITHIN DRIVEWAY SECTION, SEE DRIVEWAY STANDARD PLANS. 2.ROLLED CURB MAY ONLY BE USED WITHIN A CUL-DE-SAC OR ON A PRIVATE STREET (KENT STD. PLAN 6-18). 3.IN ROADWAY SECTIONS WITH SUPER ELEVATION, THE GUTTER PAN WILL MATCH THE ADJACENT PAVEMENT SLOPE. 4.DESIGN SIDEWALK CROSS GRADE SHALL BE 1.5%. CONSTRUCTION TOLERANCE SHALL BE 1% MIN AND 2% MAX. 5.FORMS SHALL BE STEEL UNLESS OTHERWISE APPROVED. FORMS SHALL BE SET TRUE TO LINE AND GRADE AND SECURELY STAKED PRIOR TO CONCRETE PLACEMENT. COMBINED CURB AND GUTTER ROLLED CURB SIDEWALK 5"1"6"10" 2 1/2"2 1/2"1 1 /2 "R1 1/2"R1"R1"R EXTRUDED CURB PAVEMENT NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 1% MIN. - 2% MAX. 1.5% 9"EDGE OF TRAFFIC LANE12"R13"RFULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL 1 / 2 " R MAINTAIN FLOW LINE WITHOUT VERTICAL LIP BETWEEN GUTTER AND CURB 6"12"1"6"VARIES1 1/2"R1 1/2"3"8" EXTRUDED CURB UNDER GUARDRAIL NOTE: FACE OF CURB SHALL NOT EXTEND BEYOND THE FACE OF GUARDRAIL TOWARD THE TRAFFIC LANE 18" 6" ROLLED CURB24" 4" MAINTAIN EDGE OF CONCRETE CURB + SLOPE = 1 / 2 " - SLOP E = 1 " EPOXY ADHESIVE FOR FRESH CONCRETE 6"12"1"6"DRIVEWAYADA RAMP 5'-0" HAND TROWELED TAPER SECTION 2% MAX.1.5% MAX. GUTTER SHALL BE 8" THICK AND REINFORCED WHEN INSTALLED NEAR COMMERCIAL DRIVEWAYS C OF CURBL SEE NOTE 4 1/2" FOR POSITIVE SLOPE 1" FOR NEGATIVE SLOPE 4" THICK SIDEWALK SECTION A-ANOTES: 1.AN EXPANSION JOINT CONSISTING OF 3/8" x FULL DEPTH OF PREMOLDED JOINT MATERIAL SHALL BE PLACED AROUND FIRE HYDRANTS; POLES, POSTS, AND UTILITY CASTINGS AND ALONG WALLS OR STRUCTURES IN PAVED AREAS. JOINT MATERIAL SHALL CONFORM TO THE REQUIREMENTS OF AASHTO M33 (ASTM D994). 2. AN EXPANSION JOINT CONSISTING OF 3/8" x FULL DEPTH OF PREMOLDED JOINT MATERIAL SHALL BE PLACED IN CURBS AND SIDEWALKS AT 150 FOOT MAX. INTERVALS, AT SIDES OF DRAINAGE INLETS AND AT P.C. AND P.T. OF CURB RETURNS, WHEN CURBS AND/OR SIDEWALKS ARE PLACED BY SLIP-FORMING, A PREMOLDED STRIP UP TO 1/2" THICK AND UP TO FULL DEPTH MAY BE USED. 3.EXPANSION JOINTS IN SIDEWALK SHALL BE LOCATED SO AS TO MATCH THE JOINTS IN THE CURB WHETHER SIDEWALK IS ADJACENT TO CURB OR SEPARATED BY PLANTING STRIP. NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 6.INTERFACE BETWEEN CURB AND ADJACENT SIDEWALK ON INTEGRAL POUR CONSTRUCTION SHALL BE FORMED WITH 1/4" RADIUS EDGING TOOL. ON SEPARATE POUR INSTALL BOND BREAK JOINT MATERIAL FULL DEPTH BETWEEN THE CURB OR THICKENED EDGE, ADA RAMP AND THE ADJACENT SIDEWALK. 7.ACCESS COVERS, JUNCTION BOXES, CABLE VAULTS AND OTHER APPURTENANCES WITHIN THE SIDEWALK LIMITS MUST INCLUDE A SLIP-RESISTANT SURFACE MATCHING THE GRADE OF THE SURROUNDING SIDEWALK. SUCH APPURTENANCES SHALL NOT BE PLACED WITHIN THE SLOPES OF ADA RAMPS OR DRIVEWAY WINGS. CB CB 4. CONTRACTION/CONTROL JOINTS CONSISTING OF 1/4" WIDE x 25% SLAB DEPTH SHALL BE TOOLED INTO CONCRETE FINISH AND SHALL BE MADE IN SIDEWALK AT FIVE FOOT INTERVALS, INTERMEDIATE TO THE EXPANSION JOINTS. 5. AS ALTERNATIVE TO EXPANSION JOINTS AROUND STRUCTURES, REINFORCING BARS MAY BE EMBEDDED IN CONCRETE ON FOUR SIDES OF STRUCTURES. CURB RAMP OR DRIVEWAY AA SEE KENT STANDARD PLAN SECTION 5 FOR ADDITIONAL CB GRATE REQUIREMENTS FULL WIDTH ADA DETECTABLE WARNING SURFACE (TYP.) 1/4" WIDE x 25% SLAB DEPTH (1" MIN.) CONTRACTION/CONTROL JOINT (TYP.) SEE NOTE 4 1/4" WIDE x 25% SLAB DEPTH (1" MIN.) CONTRACTION/CONTROL JOINT (TYP.) SEE NOTE 4 LEGEND: BOND BREAK JOINT EXPANSION JOINT CONTRACTION/CONTROL JOINT FULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL FULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL. SEE NOTE 6 3/8" EXPANSION JOINT (TYP.) SEE NOTE 2 3/8" EXPANSION JOINT (TYP.) SEE NOTE 2 3/8" EXPANSION JOINT (TYP.) SEE NOTE 1 FULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL. SEE NOTE 6 BLDG SIDEWALK WIDTH VARIES 1.5% 6" CEMENT CONCRETE DRIVEWAY APRON AND GUTTER FOR RESIDENTIAL DRIVEWAYS. 8" REINFORCED CEMENT CONCRETE APRON AND GUTTER FOR COMMERCIAL DRIVEWAYS. 5' 150' MAX. 5' 150' MAX. 4" CURB, GUTTER AND SIDEWALK CROSS SECTION CONTRACTION/CONTROL JOINT DETAIL "B" EXPANSION JOINT DETAIL "A" DRIVEWAY CROSS SECTION DRIVEWAY (TYP.) SEE DETAIL "A" EXPANSION JOINT 2" 4" MIN. 3/8"x FULL DEPTH EXPANSION JOINT MATERIAL, 150' MAX. O.C. SEE NOTES NOTES: 1. EXPANSION JOINT MATERIAL TO BE 3/8" x FULL DEPTH AND SHALL BE PLACED AT 150' O.C. SPACING. ELASTOMETRIC JOINT MATERIAL SHALL BE IN CONFORMANCE WITH WSDOT STD. SPECIFICATION SECTION 9-04.1 (4). 2. CONTRACTION/CONTROL JOINT SHALL BE 1/4" WIDE BY 25% SLAB DEPTH; 1" DEEP FOR 4" SLAB, 1.5" DEEP FOR 6" SLAB, 2" DEEP FOR 8" SLAB, AT 5' SPACING. 3. EXPANSION JOINTS SHALL BE INSTALLED IN CURB & GUTTER AND SIDEWALK AT P.C. & P.T. AT ALL CURB RETURNS AND ALL ANGLE POINTS. 4. FORM AND SUB-GRADE INSPECTION REQUIRED BEFORE POURING CONCRETE. 5. EXPANSION JOINTS IN SIDEWALKS AND CURBS SHALL BE ALIGNED WITH EACH OTHER AND NOT OFFSET. 6. DESIGN SIDEWALK CROSS GRADE SHALL BE 1.5%. CONSTRUCTION TOLERANCE SHALL BE 1% MIN AND 2% MAX. BROOMED FINISH PERPENDICULAR TO PEDESTRIAN TRAVEL (TYP.) CURB AND GUTTER CONTRACTION/CONTROL JOINT (TYP.) SEE DETAIL "B" 4" CONTRACTION/CONTROL JOINT, 5' O.C. SEE NOTE 2 2" CRUSHED SURFACING TOP COURSE 4" CONCRETE PER WSDOT STD. SPECIFICATION 8-14 2" 4" 2" SIDEWALK 3/8"x FULL DEPTH EXPANSION JOINT MATERIAL, SEE NOTE 1 PEDESTRIAN TRAVEL DIRECTION 2" SHINE FINISH 7.WHERE SIDEWALK CROSSES HYDRANT LATERAL; CENTER 3' WIDE PANEL ACROSS LATERAL, USE EXPANSION JOINT, SEE KENT STANDARD DETAIL 3-1. 8.ACCESS COVERS, JUNCTION BOXES, CABLE VAULTS AND OTHER APPURTENANCES WITHIN THE SIDEWALK LIMITS MUST INCLUDE A SLIP-RESISTANT SURFACE MATCHING THE GRADE OF THE SURROUNDING SIDEWALK. SUCH APPURTENANCES SHALL NOT BE PLACED WITHIN THE SLOPES OF ADA RAMPS OR DRIVEWAY WINGS. SS FOR NEW SEWER CONSTRUCTION; STAMP FACE OF CURB WHERE SIDE SEWER CROSSES PERPENDICULAR TO CURB. 3" HIGH LETTERS 1/4" DEPTH. 4" SHINE FINISH 4" EXPANSION JOINT (TYP.) SEE DETAIL "A" PLANTER STRIP (WHEN REQ'D) EXPANSION JOINT (TYP.) SEE DETAIL "A" FULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL 2" SHINE FINISH SHINE FINISH 4" SHINE FINISH (TYP.) SEE DETAIL "A" EXPANSION JOINT TYP. SEE NOTE 6 NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 1.5% MAX CROSSWALKS NON ARTERIAL RAMP LOCATIONS ACCEPTABLE RAMP LOCATIONS FOR RETROFIT OR ALTERATION NOTE: 1.CATCH BASIN INLETS, JUNCTION BOX AND VAULT LIDS SHALL BE OUTSIDE CURB RAMPS WITH 32" MIN. CLEARANCE FROM RAMP. 2.CARE SHALL BE TAKEN TO KEEP THE RAMP FROM CONFLICTING WITH HYDRANTS, POLES, INLETS AND OTHER UTILITIES. 3.RAMPS SHALL BE CONSTRUCTED IN ACCORDANCE WITH WSDOT STD. PLANS F-40.12-03 THRU F-45.10-02. 4.CROSSWALKS ARE NOT ALWAYS MARKED. 5.WHEN RAMPS ARE CONSTRUCTED ON THE SIDE OF STREET THEY SHALL BE ALIGNED WITH THE COMPANION CROSSING ON THE OPPOSITE SIDE OF STREET. 6.CURRENT ADA LAWS FOR LANDING SIZE, DETECTABLE WARNING PATTERNS, SKID RESISTANCE AND RAMP DIMENSIONS AND SLOPES SHALL BE COMPLIED WITH AT ALL TIMES. 7.YELLOW DETECTABLE WARNING SURFACE SHALL BE WSDOT F-45.10-02 AND IN COMPLIANCE WITH WSDOT STD. SPEC. 8-14.2. WET EMBOSSED CONCRETE AND PAINTING IS NOT ALLOWED. 8.ACCESS COVERS, JUNCTION BOXES, CABLE VAULTS AND OTHER APPURTENANCES WITHIN THE SIDEWALK LIMITS MUST INCLUDE A SLIP-RESISTANT SURFACE MATCHING THE GRADE OF THE SURROUNDING SIDEWALK. SUCH APPURTENANCES SHALL NOT BE PLACED WITHIN THE SLOPES OF ADA RAMPS OR DRIVEWAY WINGS. PEDESTRIAN APPROACH 12" GUTTER 6"CURB INTERSECTION MAINTAIN FLOW LINE WITHOUT VERTICAL LIP BETWEEN GUTTER AND CURB SLOPESLOPE SECTION A-A (TYP.) 2' DETECTABLE WARNING SURFACE VARIES VARIESVARIESSIGNAL CONTROLLER CABINET = 7' MIN. FROM FACE OF CURB 5' MIN. FROM C/L OF PEDESTRIAN PUSH BUTTON POLE TO NEAREST EDGE OF CURB RAMP (TYP.) RAMPS, SEE NOTE 3 (TYP.) FULL WIDTH ADA DETECTABLE WARNING SURFACE 2' WIDE (TYP.) CENTER OF DETECTABLE WARNING SURFACE BETWEEN CROSSWALKS SHALL BE BLACK TO PROVIDE DIRECTIONALITY ARTERIAL RAMP LOCATIONS FOR NEW CONSTRUCTION OR STANDARD RECONSTRUCTION A A (TYP.) 7.5% MAX. 7.5 % MA X . RAMPS, SEE NOTE 3 (TYP.) RAMPS, SEE NOTE 3 (TYP.) EXTENDED PARALLEL CURB RAMP PEDESTRIAN CURB SEE KENT STANDARD PLAN 6-33 A A (TYP.) NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. PROVIDE TRANSITION SIDEWALK, 5' MIN. WHEN TRANSITIONING TO EXISTING SIDEWALK PROVIDE TRANSITION SIDEWALK, 5' MIN. WHEN TRANSITIONING TO EXISTING SIDEWALK 1:12 SLOPE OR 7.5% MAX PAVED DRIVEWAY TAPER MATERIAL SHALL MATCH DRIVEWAY TYPE AND DEPTH. WIDTH SHALL MATCH SIDEWALK RAMP LENGTH.PER PLANS DRIVEWAY APPROACH WIDTH SPECIFIED ON PLANS DRIVEWAYS SHALL BE SYMMETRICAL. FIRE HYDRANTS, STREET LIGHTS, UTILITY POLES, GUY WIRES AND OTHER OBSTACLES MUST BE RELOCATED 5' MINIMUM FROM THE DESIGN VEHICLES TURNING RADIUS EXPANSION JOINT (TYP.) SEE NOTE 3 1.CONCRETE WITHIN 8" THICK LIMITS SHALL BE PORTLAND CEMENT CONCRETE MIX WITH A COMPRESSIVE STRENGTH OF 3000 PSI IN 3 DAYS. FINISH SHALL BE BRUSHED TRANSVERSELY WITH A FIBER OR WIRE BRUSH, "BROOM FINISH". 2.ALL UTILITY APPURTENANCES WHICH ALTER THE TRAVEL SURFACE SHALL NOT BE ALLOWED. DESIGN OF STORM DRAIN CATCH BASINS SHALL CONSIDER DRIVEWAY LAYOUT AND BE AVOIDED. 3.EXPANSION JOINTS SHALL BE PLACED AT 15' MAXIMUM SPACING. ELASTOMETRIC JOINT MATERIAL SHALL BE IN CONFORMANCE TO AASHTO M220. 4.SEE STANDARD PLAN 6-48 FOR DRIVEWAY SLOPES BEHIND SIDEWALK. 5.ENTERING SIGHT DISTANCE SHALL MEET AASHTO STANDARDS AND DETAILS 6-50 THRU 6-54. 6.DESIGN SIDEWALK CROSS GRADE SHALL BE 1.5%. CONSTRUCTION TOLERANCES SHALL BE 1% MIN AND 2% MAX. NOTES: SECTION A-A 1'-6" 8" 6" CRUSHED SURFACING TOP COURSE 4" MIN. DEPTH 1/2" TYP. 1" FOR REVERSE SLOPE DRIVEWAY #4 BARS AT 12" EACH WAY; WIRE TIED AT EACH INTERSECTING POINT; SUPPORTED BY 2" SQUARE MORTAR CUBE OR INDUSTRY STANDARD "CHAIR" AND 3' MAXIMUM SPACING OF SUPPORTS. BAR SHALL EXTEND BEYOND CONSTRUCTION JOINTS AND LAPPED A MINIMUM OF 15" AT SPLICE POINTS. 2" CLEAR FROM SUBGRADE 4" CLEAR TYPICAL 5'-0" MIN. 1.5% MAX. LIMITS FOR 8" THICK REINFORCED DRIVEWAY SEE NOTE 2 6' MIN., 15' MAX. 6' (TYP.) 2- #4 BARS 8" FULL DEPTH BOND BREAK MATERIAL: 30 LB ROOFING FELT, 6 MIL PLASTIC OR APPROVED EQUAL A A NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 7. ACCESS COVERS, JUNCTION BOXES, CABLE VAULTS AND OTHER APPURTENANCES WITHIN THE SIDEWALK LIMITS MUST INCLUDE A SLIP-RESISTANT SURFACE MATCHING THE GRADE OF THE SURROUNDING SIDEWALK. SUCH APPURTENANCES SHALL NOT BE PLACED WITHIN THE SLOPES OF ADA RAMPS OR DRIVEWAY WINGS. 8. PROVIDE TRANSITION SIDEWALK, 5' MIN. WHEN TRANSITIONING TO EXISTING SIDEWALK. 8" DIA. 1" MIN./6" MAX. 9 1/4" DIA. COVER 3/8" DISC 3" BRASS 12"NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. FINISHED GRADE ASPHALT PAVEMENT NOTES: 1. MONUMENT CASE AND COVER - EAST JORDAN IRON WORKS, PART NO. 369505 OR PRE-APPROVED ALTERNATIVE. 2.MONUMENT CASE RISER - EAST JORDAN IRON WORKS, PART NO. 1 1/2" - 369590 2" - 369592 3" - 639594 OR PRE-APPROVED ALTERNATIVE. 3. MONUMENT POST - SHOPE CONCRETE PRODUCTS, PART NO. 104 OR PRE-APPROVE ALTERNATIVE. 4. THE CASTINGS SHALL BE GRAY-IRON CASTINGS, ASTM DESIGNATION A-48, CLASS 35B. THE COVER AND SEAT SHALL BE MACHINED SO AS TO HAVE PERFECT CONTACT AROUND THE ENTIRE CIRCUMFERENCE AND FULL WIDTH OF BEARING SURFACE. 4" MIN. ASPHALT PAVEMENT FINISHED GRADE CONCRETE PAVEMENT 10" - 12"10"9"VOID OF MATERIAL 5 3/4" R. MONUMENT NATIVE MATERIAL 1 1/2" MIN.NO. 5 REBAR16"11" DIA. 9 1/2" DIA. 8" DIA. 9 1/16" DIA. 3/4" 7/8" 8" RISER RING DIMENSIONS 1 3/8"1 7/8"2 7/8"A (SIZE)3"5/8" E J I W MO N MADE I N U S A SECTION4 3/4"CONCRETE AS SPECIFIED FOR ROADWAY 4" 5 1/2"4"5 1/2"DIMENSIONS PER SPECIFIED ROADWAY STANDARD5 1/2" 5. CONCRETE SHALL BE A "COMMERCIAL CLASS" CONCRETE OR AS OTHERWISE SPECIFIED. 6. PAVEMENT SHALL BE AS SPECIFIED. 7.FOR ALTERNATE DIAMETER RISERS SEE KSP 6-72b.DIMENSIONS PER SPECIFIED ROADWAY STANDARD2"(TYP.) PLAN OF MONUMENT CONCRETE COLLAR A 3" RISER PLAN OF COVER PLAN OF 8" DIA. RISER NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NEW FINISHED GRADE ASPHALT PAVEMENT NOTES: 1.MONUMENT CASE RISER - SEE APPROPRIATE TABLE ABOVE OR PRE-APPROVED ALTERNATIVE. 2.MONUMENT CASE COVER - SEE APPROPRIATE TABLE ABOVE OR PRE-APPROVED ALTERNATIVE. 3.THE CASTINGS SHALL BE GRAY-IRON CASTINGS, ASTM DESIGNATION A-48, CLASS 30. THE COVER AND SEAT SHALL BE MACHINED SO AS TO HAVE PERFECT CONTACT AROUND THE ENTIRE CIRCUMFERENCE AND FULL WIDTH OF BEARING SURFACE. 4.CONCRETE SHALL BE CLASS 4000. 5.PAVEMENT SHALL BE AS SPECIFIED. NEW FINISHED GRADE ASPHALT PAVEMENT MONUMENT A DIA. VARIES DIA. VARIES DIA. VARIESOLD FINISH GRADE CONCRETE PAVEMENT OLD FINISH GRADE ASPHALT PAVEMENT EXISTING UNDISTURBED CASE TACK COAT (TYP.) 7" CASE RISERS - EAST JORDAN IRON WORKS A (SIZE) NATIVE MATERIAL TACK COAT (TYP.) 1" PART # 369068 1 1/2" PART # 369090 2" PART #369092 3" PART #369094 COVER PART # 369027/3690C 8" ALT. CASE RISERS - EAST JORDAN IRON WORKS A (SIZE)1 1/2" PART # 368090 2" PART #368092 COVER PART # 3680A2 FOGTITE CASE RISERS - FOGTITE METER SEAL CO. A (SIZE)1" PART #VB RISER 4#2" PART # VB RISER 5# 2 1/2" PART # VB RISER 5 1/2#3" PART # VB RISER 6# COVER PART # 0-1 VB 8# 6. IF MONUMENT CASE IS TO BE DISTURBED THEN A NEW MONUMENT, CASE AND COVER IS TO BE INSTALLED PER KENT STANDARD PLAN 6-72a. SECTION TRAFFIC DIRECTION 18" YELLOW BARRIER LINE1" BARRIER LINE 18"-TYPE 2Y RPM'S EQUALLY SPACED 21'(TYP.) TRAFFIC DIRECTION TRAFFIC DIRECTION TYPE 2Y RPM 30'11' SKIP CENTER LINE 1' 4" YELLOW LINE TRAFFIC DIRECTIONTRAFFIC DIRECTION WIDE LINE 8" WHITE LINE 3'9' 8" WHITE LINE DROP LANE LINE TYPE 2W RPM 1" EDGE LINE 4" WHITE OR YELLOW LINE 1' TYPE 2W RPM 30'11' 4" WHITE LINE LANE LINE 6' 8" WHITE LINE TYPE 2W RPM 8' DOTTED WIDE LINE 4" YELLOW LINE DOUBLE YELLOW CENTER LINE TYPE 2YY RPM 4" GAP 20' TRAFFIC DIRECTION TWO WAY LEFT TURN LINES TRAFFIC DIRECTION 4" GAP 10' VARIES (300' MAX.) TWO WAY LEFT TURN LANE5'2.5' 30'1' TYPE 2W RPM 4" GAP 20' 4" GAP NOTE: 1.SEE SECTION 6.12.B FOR PLASTIC MATERIAL SPECIFICATIONS. 2.RAISED PAVEMENT MARKERS (RPM'S) SHALL BE INSTALLED PER WSDOT STANDARD SPECIFICATIONS 8-09, 9-02.1(8), 9-26.2 AND 9-21. TRAFFIC DIRECTION TRAFFIC DIRECTION TRAFFIC DIRECTION TRAFFIC DIRECTION TRAFFIC DIRECTION NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NOTES: 1. FOR ROADWAYS WITH MORE OR LESS LANES, THE SAME CONFIGURATION APPLIES, CENTER THERMOPLASTIC BARS ON THE LANE LINES, AND IN THE CENTER OF THE TRAVELED PORTION OF THE LANE TO MINIMIZE TIRE WEAR ON THE THERMOPLASTIC. 2. THE CENTERLINE OF THE CROSSWALK SHALL GO FROM THE CENTERLINE OF THE CURB RAMP ON ONE SIDE OF THE STREET TO THE CENTERLINE OF THE CURB RAMP ON THE OTHER SIDE OF THE STREET UNLESS OTHERWISE SHOWN ON THE PLANS. 3. GLASS BEADS (PER WSDOT STANDARD SPECS. SECTION 9-34) SHALL BE ADDED TO ALL THERMOPLASTIC CROSSWALKS AND STOP BARS. 4.SEE SECTION 6.12.B FOR PLASTIC MATERIAL SPECIFICATIONS. 5.THE CROSSWALK WIDTH IS 12' IN DOWNTOWN OVERLAY DISTRICT. TYPICAL 4 LANE ROADWAY CONFIGURATION * * TIRE TRACKS (TYP.)GUTTER LINE OR EDGE OF TRAVELED LANE12" SPACED (TYP) EQUALLY LANELCROADWAYLCLANELC24" WHITE THERMOPLASTIC CROSSWALK LINE 24" 10' 4' MIN 12"-24" WHITE STOP LINE, WIDTH AS DIRECTED BY THE ENGINEER NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. STOP BAR DETAIL NOTES: 1. THERMOPLASTIC TYPE 'A' MATERIAL SHALL BE USED, UNLESS DIRECTED OTHERWISE BY THE ENGINEER. PLACEMENT PER WSDOT STANDARD SPECIFICATION 8-22, MATERIALS PER WSDOT 9-34. 2. GLASS BEADS (PER WSDOT STANDARD SPECS. SECTION 9-34) SHALL BE ADDED TO ALL THERMOPLASTIC CROSSWALKS AND STOP BARS. 3. SEE SECTION 6.12.B FOR PLASTIC MATERIAL SPECIFICATIONS. 5'-9"8'-0"1'-8"12'-0"0'-6" 3'-0"12'-0"0'-6"0'-6" 3'-7" 0'-6"20'-0"LENGTH VARIES 12"-24" WIDE WHITE STOP BAR, WIDTH AS DIRECTED BY THE ENGINEER NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. ADJACENT TO THE W10-1 SIGNLANE LINE OR CENTERLINE 1'-4"(T Y P ) NOTES: 1. RR CROSSING SYMBOL 2. 24" WIDE STOP LINE 3. W10-1 ADVANCE WARNING SIGN 4. SEE THE MUTCD PART 8, FOR LETTER LAYOUT. 5.SEE SECTION 6.12.B FOR PLASTIC MATERIAL SPECIFICATIONS. EDGE LINE NARROW RR CROSSING SYMBOL DETAILS RAILROAD - HIGHWAY GRADE CROSSINGS NARROW PAVEMENT MARKING PLACEMENT DETAILSOME PORTION OF THIS LAYOUT SHOULD BE24'-0"±20'-0"16'-0"±SEE MUTCD PART 816'-0"±SEE NOTE 3SEE NOTE 1SEE NOTE 420'-0"6'-7" 3'-3"3'-3"1'-6"6'-0"3'-4" 1'-8"6'-0"1'-2"1'-2" 1'-0" SEE NOTE 2 SEE NOTE 2 SEE NOTE 2 MEASURED FROMNEAREST TRACKSEE NOTE 1 NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NOTES: 1.PER BIKE RIDER SYMBOL DETAIL. 2.PER ARROW DETAIL ON THIS PLAN. 3.BIKE PAVEMENT MARKINGS SHALL BE PLACED IMMEDIATELY AFTER EVERY INTERSECTION AND AT PERIODIC INTERVALS WITH A MAXIMUM SPACING OF 600 FEET, CENTERED IN LANE. 4.SEE ROADWAY CROSS SECTION STANDARD PLANS 6-2 TO 6-13. 5.ALL MARKINGS SHALL BE WHITE PLASTIC MATERIAL AS SPECIFIED IN ACCORDANCE WITH WSDOT STANDARD SPECIFICATION 9-34, TYPE D (MMA). CORUNDUM SHALL ALSO BE ADDED. 6.SIGNING SHALL BE PER THE MUTCD. 7.SEE SECTION 6.12.B FOR PLASTIC MATERIAL SPECIFICATIONS. BIKE LANE LAYOUT ARROW DETAIL FACE OF CURB LINE OR EDGE OF PARKING SEE NOTE 3 SEE NOTE 1 3'-0" 6" SEE NOTE 2 BIKE RIDER SYMBOL DETAIL PEDESTRIAN SYMBOL DETAIL H W 6'-0" 3'-4" 30MPH OR LESS SPEED 35MPH OR GREATER 4'-0" 6'-0" 2'-1" 3'-2" H W 2'-8" 6'-0" 3" 1'-0" EDGE OF 8" SOLID WHITE LANE LINE TRAFFIC DIRECTION6'-0" 5' NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. TWO WAY LEFT TURN LANENOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NOTE: SEE STANDARD PLANS 6-73 OR 6-74 FOR LANE MARKING LAYOUT.100'100' MIN.50'DOUBLE YELLOWCENTERLINELANE LINEWIDE LINELANE LINE v NOTES: ATTACH SIGNS 30" AND UNDER HEAVY DUTY BUCKLE TYPE 201 WITH 2 DRIVE RIVETS AND BLACK INSULATED WASHERS, SEE NOTE 5 ATTACH SIGNS 36" AND OVER WITH CORNER BOLTS AND BLACK FLARED LEG BRACKETS INSULATED WASHER, SEE NOTE b � 5S 0.030 BAND -IT BRACKET SEE NOTES 9 AND 10 OR APPROVED EQUAL D SIGN PAST SQUARE 2"x 2", 0 14 GAGE. ALL HOLES ° PRE -PUNCHED D D CORNER BOLT, 3" SEE NOTE 6 0 D FINISHED GRADE ° D 5/16" x 1" SS ° \ \ \ \ �'�: i'��i'��i'��i'�• BOLTS WITH BLACK ° INSULATE❑ D �`� SET FOUNDATION ON WASHERS J ° < UNDISTURBED NATIVE SOIL Y ° OR COMPACTED MATERIAL 0 ° SET ANCHOR PLUMB AND 3, ° TRUE, SEE NOTE 3 0 D CONCRETE BASE SHALL BE MOUNTING ON STREET LIGHT 0 POURED IN PLACE AROUND STANDARD OR SIGNAL POLE ✓ D ANCHOR WHILE PREVENTING ✓ /i CONCRETE FROM ENTERING THE ANCHOR MIN. 1. METAL POSTS SHALL BE TELESPAR POST STEEL PIPE TYPE, OR APPROVED EQUIVALENT. 2. FOR IN -SIDEWALK INSTALLATIONS, CORE AN 8" DIAMETER HOLE PRIOR TO EXCAVATION. 3. ANCHOR LENGTH SHALL BE 30", LENGTH MAY BE REDUCED TO 24" OR SIGN POST BASE PLATE INSTALLATION TYPE B (SEE DETAIL 6-82h) MAY BE USED; ONLY IF APPROVED BY THE CITY OF KENT, ANCHOR SHALL HAVE 4 EACH 7/16" DIAMETER HOLES ONE EACH SIDE 2" FROM TOP. FINISH SHALL BE ZINC HOT DIPPED GALVANIZED MATERIAL TO MEET ASTM A500 GRADE B, 7 GAUGE, 2 1/2"x 2 1/2" TELESPAR ANCHOR OR APPROVED EQUIVALENT. 4. POST SHALL BE ROLLED CARBON SHEET STEEL, ASTM A1011 GRADE 50 AND BE HOT DIPPED GALVANIZED AASHTO M120 YIELD STRENGTH 60,000 PSI MIN. SQUARE POST SHALL HAVE 7/16" DIAMETER PRE -PUNCHED HOLES ON 1" CENTERS FULL LENGTH, FOUR SIDES. rFFR�y� S a� wA,�r VZ17 z 5. DRIVE RIVETS TO BE TL3806 3/8" DIAMETER 6. CORNER BOLTS TO BE TL070M. ]AMNUTS TL062 AND 3/8" GALVANIZED WASHER WITH BLACK INSULATED WASHER. 7. SEE STANDARD PLAN 6-83M AND 6-84M FOR STREET NAME SIGN DETAILS. S. PRIVATE STREET NAME SIGNS AND PRIVATE SIGN POSTS ARE MAINTAINED BY THE PROPERTY OWNERS. 9. ALUMINUM SIGN BLANK THICKNESS; WARNING AND REGULATORY 30" AND UNDER - 0,080". WARNING AND REGULATORY 36" AND OVER - 0.125" 10. SHEETING MATERIAL: WARNING AND REGULATORY - 3M HIGH INTENSITY PRISMATIC SCHOOL SIGNS - 3M DIAMOND GRADE DG3 LEGENDS, SYMBOLS AND BORDERS - 3M ELECTROCUT FILM NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NOTES: 1.CITY OF KENT APPROVAL REQUIRED PRIOR TO USING BASE PLATE. 2.SEE STANDARD PLAN 6-82a FOR SIGN POST AND SIGN NOTES AND DETAILS. PLAN PRE-GALVANIZED LOW CARBON 12 GA (ASTM A653 GRADE 33) PERFORATED SQUARE TUBING CENTERED ON BASE PLATE 7"x7"x1/4" STEEL BOTTOM PLATE (ASTM A240 SS GRADE 33) 3/4" DIAMETER HOLES1"1"2 1/4"2 1/4" BASE PLATE ELEVATION8"WELD ALL AROUND 7"x7"x1/4" STEEL BOTTOM PLATE (ASTM A240 SS GRADE 33) 1/2"x5 1/2" SS WEDGE ANCHORS, SS WASHERS AND NUTS PRE-GALVANIZED LOW CARBON 12 GA (ASTM A653 GRADE 33) PERFORATED SQUARE TUBING CENTERED ON BASE PLATE 7/16" ON 1" CENTER DIA. HOLES NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 1.FOR TYPE 1 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.10. 2.FOR TYPE 2 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.10. 3.FOR TYPE 4 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.20. 4.FOR TYPE 5 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.20. 5.FOR TYPE 6 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.20. 6.FOR TYPE 8 JUNCTION BOX, SEE WSDOT STANDARD PLAN J-40.30. NOTE: 1.FOR SECURITY NON-LOCKING JUNCTION BOX LIDS SHALL BE TACK WELDED AT TWO POINTS AFTER FINAL INSPECTION AND ACCEPTANCE. TOP VIEW OF BASE NOTES: BOTTOM VIEW OF CABINET NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. 1. PAINT TOP OF BASE SILVER. 2. DRAIN HOLE SHALL NOT BE INSTALLED. 3. THE TOP OF THE BASE SHALL BE FLAT AND LEVEL. 4. TOP OF BASE IS 1" WIDER THAN CONTROLLER CABINET ON ALL FOUR SIDES. CONTROLLER UPS CONTROLLER DOOR OPENS TOWARD SIDEWALK, UPS DOOR TO RIGHT 6"22"-24" HEIGHT ABOVESIDEWALK OR PAD2'-0"2'-8"6'-6" 1" (SEE NOTE 4) CONDUITS (TYP)QUICK OR HILTI-ANCHOR BOLT ASSEMBLY (TYP) 1/2" WEATHER PROOF CAULK. SEAL OUTER EDGES OF CABINET AND FOUNDATION CONCRETE BASE (CLASS 3000) 2" PVC CONDUITS PROTRUDE 1/2" ABOVE BASE SEE NOTE 3 1" SEPARATION SEE NOTES 1 AND 2 1" MIN., TYP. ALL SIDES END VIEW NOTE: CUT DRAIN WIRESOLDERLESS, CRIMPED, NON-INSULATED BUTT SPLICE SIDE VIEW SCOTCH 06147 ELECTRICAL MOISTURE SEALANT TAPE STOP BAR JUNCTION BOX B SFA BS*AF BF AS #14 TWISTED PAIR WIRE TYPE IMSA 51-3, 3 TWISTS PER FOOT TO CONTROLLER JUNCTION BOX LOOP SERIES NUMBER ***S=START F=FINISH **F S*WEARING COURSE (TYPICAL FOR SECTIONS A, B & C) 0.25" MINIMUM WIDTH SAWCUT3"0.50" MINIMUM WIDTH SAWCUT 0.50" MINIMUM WIDTH SAWCUT3"3"A A A A B B C C4'TO ADDITIONAL LOOPS WHERE APPLICABLE S F A A STOP BAR LOOP WINDING DETAIL CENTER OF LANE CENTER OF LANE LOOP SPLICE (TYPICAL) =LOOP NUMBER S=START F=FINISH *=LOOP NUMBER CONDUIT STUBOUT, SEE STANDARD PLAN 6-99 EDGE OF PAVED SHOULDERNOTES: 1. SEE KENT STANDARD PLAN 6-99 FOR CONDUIT STUBOUT DETAIL AND INDUCTION LOOP INSTALLATION NOTES. 2. SEE KENT STANDARD PLAN 6-100 FOR INDUCTION LOOP PLACEMENT DETAIL. F S OR CURB(ASSUMING TWO LANES OF LOOPS) TO ADDITIONAL LOOPS WHERE APPLICABLE B B C C LOOP SERIES NUMBER 2C(S) LEAD-IN CABLE IMSA 50-2 B B C C #14 TWISTED PAIR WIRE TYPE IMSA 51-3, 3 TWISTS PER FOOT 2C(S) LEAD-IN CABLE IMSA 50-2 TO CONTROLLER SECTION A-A SECTION B-B SECTION C-C SINGLE LOOP WINDING DETAIL LOOP SPLICE DETAIL NO BACKER RODS ALLOWED. NOTE: NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. NOTE: THIS PLAN IS NOT A LEGAL ENGINEERING DOCUMENT BUT AN ELECTRONIC DUPLICATE. THE ORIGINAL, SIGNED BY THE ENGINEER AND APPROVED FOR PUBLICATION IS KEPT ON FILE AT THE CITY OF KENT. A COPY MAY BE OBTAINED UPON REQUEST. EXISTING PAVEMENT EDGE OF PAVED SHOULDER (SHOWN) OR EDGE OF EXTRUDED CURB OR EDGE OF GUTTER PAN OR EDGE OF TRAFFIC BARRIER LEAD SCH 80 CONDUIT FULL DEPTH SAWCUT MATCH EXISTING PAVING MATERIAL 3/4" ABOVE BOTTOM OF PAVEMENT CONDUIT END BELL BUSHING, SEAL WITH DUCT SEAL LOOP LEAD WIRES ~ TWISTED PAIR 2 5/8" MIN. ~ 3" MAX. LOOP LEAD SAWCUT DETECTOR LEAD 2C(S) CABLE LOOP STUB-OUT SLEEVE (1/4" TO 1/2" BELOW TOP OF ASPHALT) CONDUIT CONDUIT STANDARD JUNCTION BOX 6"1' - 0"2' - 0" MINIMUM FROMTOP OF PAVED SURFACESOFT POCKET TO JUNCTION BOX TO CABINET TO LOOP LOOP LEAD WIRES ~TWISTED PAIR 2"±1.CONDUIT USED FOR STUB-OUTS SHALL BE SCHEDULE 80 PVC CONDUIT, MINIMUM SIZE 2 INCHES. 2.ALL LOOPS SHALL BE WOUND WITH THREE TURNS OF NO. 14 AWG STRANDED COPPER WIRE, CLASS B, WITH CHEMICALLY CROSS LINKED POLYETHYLENE TYPE USE INSULATION OF CODE THICKNESS. 3.BACKER ROD WILL NOT BE USED WITH CITY OF KENT LOOP INSTALLATIONS. 4.LEAD WIRES: FOUR PAIR MAXIMUM PER SAWCUT. 5.EXTEND SAWCUT SUFFICIENT LENGTH TO PROVIDE FULL SAWCUT DEPTH AROUND CORNERS. 6.LOOPS SHALL BE INSTALLED PRIOR TO FINAL LIFT IF NEW PAVEMENT IS INSTALLED. 7.ALL LOOPS SHALL HAVE IDENTIFYING LABELS ON THEIR LEADS SHOWING LOOP NUMBER AND S (START) OR F (FINISH). 8.SEE STANDARD PLAN 6-98 FOR INDUCTION LOOP DETAILS AND STANDARD PLAN 6-100 FOR INDUCTION LOOP PLACEMENT. 9.WHEN SAWCUTTING LEAD SLOT IN THE ROADWAY, CONTINUE THE SAW CUT APPROXIMATELY ONE INCH BEYOND THE SEAM WITH THE CONCRETE GUTTER A DEPTH OF APPROXIMATELY ONE INCH TO PERMANENTLY MARK THE LOCATION OF THE STUBOUT. IF NO GUTTER IS PRESENT, CONTACT THE ENGINEER FOR AN ALTERNATIVE METHOD OF MARKING THE STUBOUT LOCATION. 10.ALL LOOP LEADS RETURNING TO JUNCTION BOX SHALL BE PLACED A MINIMUM OF 2 FEET AWAY FROM ANY AND ALL METAL CASTINGS OR VALVE BOXES EXCEPT TERMINATING HANDHOLES OR JUNCTION BOXES. 11.SEE DETAIL 6-98 FOR SPLICE METHOD. EPOXY SPLICE KITS ARE NOT ALLOWED. INDUCTION LOOP INSTALLATION NOTES: CSTC OR CONTROLLED DENSITY FILL SAND SPLICE GRAVEL PAD 50' MAXIMUM DISTANCE SEE STUB-OUT CONDUIT PLACEMENT DETAILS 6"6"4" 212th St. Preservation/Holcomb A - 2 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 WSDOT STANDARD PLANS DRAINAGE STRUCTURES AND HYDRAULICS B-30.15-00 ADA Grates for Rectangular Frames B-30.70-04 Circular Frame (Ring) and Cover CURBS, SIDEWALKS AND DRIVEWAYS F-10.12-03 Cement Concrete Curbs F-10.42-00 Extruded Curb F-10.62-02 Precast Sloped Mountable Curb (2 sheets) F-45.10-02 Detectable Warning Surface SITE PRESERVATION AND EROSION CONTROL I-40.20-00 Storm Drain Inlet Protection ILLUMINATOIN, SIGNALS, AND ITS J-20.15-03 Accessible Breakaway Pedestrian Pushbutton (PPB) Post J-20.20-02 Pedestrian Signal Standard (Type PS) Electrical Detail J-20.26-01 Accessible Pedestrian Pushbutton (PPB) Details (2 sheets) J-75.10-02 Signal Head Mounting Details ~ Pole and Post Top Mountings IS-2 APS PPB Extension Detail IS-12 Typical Pedestrian Pushbutton Post Placement ROADWAY DELINEATION M-7.50-01 High Occupancy Vehicle (HOV) Lane Symbol Layout M-9.50-02 Bicycle Lane Symbol Layout M-80.10-01 Traffic Letter and Numeral Applications (2 sheets) M-80.30-00 Traffic Letters and Numerals (Low Speed Roadways) 29 1 /4" PLAN VIEW GRATEFRAME FOR DETAILS NOT SHOWN, SEE STANDARD PLAN B-30.10 PLAN VIEW GRATE ALTERNATIVE 1 ISOMETRIC VIEWS (GRATE ALTERNATIVE 1 SHOWN) NOTES 1. Bolt -down capability is required on all frames, grates, and covers, unless specified otherwise in the Contract. Provide 2 holes in the frame that are vertically aligned with the grate or cover slots. The frame shall accept the 304 Stainless Steel (S.S.) 5/8" (in) - 11 NC x 2" (in) Allen head cap screw by being tapped, or other approved mechanism. Location of bolt -down holes varies by manufacturer. 2. All grates shall be 20" (in) x 24" (in). 3. Grate alternatives shown for informational purposes. Grate design varies by manufacturer and must meet ADA requirements. 4. Refer to Standard Specification Section 9-05.15 and 9-05.15 (2) for additional requirements. 1/2" �J �„ (TYP.) 1/2 (TYP.) 1 (TYP.) � uui uuu w i_i�,u- �- -1H lfl--- PLAN VIEW GRATE ALTERNATIVE 2 PLAN VIEW GRATE ALTERNATIVE 3 OF WASyI��y �O ,y 4181e O W� 'p6' IST84Q 11' ssIONAL 4'�� p. �( _�j Hcilmen.Julie �6 cC�y �V],�Yn,,.t,�� Fc62D M1812:53 PM ADA GRATES FOR RECTANGULAR FRAMES STANDARD PLAN 0-30.15-00 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Ctryrnm.M ,6G",fr[J FeE3i it116T.9iAM STNTE DESIGN ENGINEER Washington Stafe Department of Twnsporlation BLIND PICK NOTCH DETAIL"A" 1 7/16" I m 1 51 /16" i RING PLAN 27 5/8" 26 3/8" 1" p 5/8" za" "a 26 3/4" 34 1/8" SKID GROOVE PATTERN --- D WASHER TOP_ (SEE NOTES) BOTTOM � v m 1/2" (MIN.) 1/4" (IN) DOVETAIL GROOVE WITH NEOPRENE GASKET (SEE NOTES) BOLT -DOWN / WATERTIGHT DETAIL "B" RING SECTION O COVER PLAN Q.. nt RING PLAN 27 5/8" 26 3/8" 1" I I O 5/8" "v=�126 n 3/4" 34 1 /8" RING SECTION O (TAIL "A" SEE DETAIL "A" TOP BOTTOM COVER PLAN m - SEE DETAIL "A" n W COVER SECTION O (SEE NOTE 7) STANDARD TYPE1 SEE DETAIL "B" SEE DETAIL "A" a �� COVER SECTION Og (SEE NOTE 7) BOLT -DOWN / WATERTIGHT TYPE 2 NOTES 1. The gasket and groove may be in the seat (frame) or in the underside of the cover. The gasket may be "T" shaped in section. The groove may be cast or machined. 2. Bolt -down capability is required on all frames, grates, and covers, unless specified otherwise in the Contract. Provide 3 holes in the frame that are vertically aligned with the grate or cover slots. The frame shall accept the 304 Stainless Steel (S.S) 5/8" - 11 NC x 2" (in) alien head cap screw by being tapped, or other approved mechanism. Location of bolt down holes varies by manufacturer. 3. For bolt -down manhole ring and covers that are not designated "Watertight," the neoprene gasket, groove, and washer are not required. 4. Washer shall be neoprene (Detail "B"). 5. In lieu of blind pick notch for manhole covers, a single 1" (in) pick hole is acceptable. Hole location and number of holes may vary by manufacturer. 6. Alternative reinforcing designs are acceptable in lieu of the rib design. 7. For clarity, the vertical scale of the Cover Section has been exaggerated, it is 1.5 times the horizontal scale (1 H:1.5V). ISOMETRIC VIEW -" i1 SKID GROOVE PATTERN DETAIL pF WAS#,,, �O ,y 41819 O W� 'pF OI S T84Q 1� ss10NAL n Heilman, Julio Feb. ?0?018 I?;Si P11 CIRCULAR FRAME (RING) AND COVER STANDARD PLAN B-30.70-04 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION STATE DESIGN ENGINEER Washington Stafe Department of Twnsporlation FACE OF CURB VARIES 72" TO 29" FACE OF CURB VARIES 7" 10- TO 22" 1" I'ON R. (SEE CONTRACT) V (IN R. MATCH ROADWAY SLOPE MATCH ROADWAY SLOPE 112- (IN) R. b ", n ' • a 6 12" (1N) R. ROADWAY -� ° ROADWAY DUAL -FACED CEMENT CONCRETE TRAFFIC CURB AND GUTTER FACE OF CURB FACE OF CURB 6 18" s V2- VARIES FROM B" (IN] TO 0" (IN) - MAINTAIN I ! 6V SLOPE 5 7I2- 7" VARIES 4R,.O� "(IN ON SIDE OF CURB T- (IN R 112-(IHj R MATCH ROADWAY MATCH ROADWAY SLOPE 1!7" (INj R SLOPE I IQ' (IN) ROADWAY-_--__'1wON] ROADWAY Fa n ,• R 0 6 =2Al R " a I0 '• ° m FLUSH WITH GUTTER PAN AT CURB 1O RAMP ENTRANCE - 1Y1" (IN) VERTICAL 1 �'-8- UP AT DRIVEWAY ENTRANCE CEMENT CONCRETE DEPRESSED CURB SECTION TRAFFIC CURB AND GUTTER AT CURB RAMPS AND DRIVEWAY ENTRANCES CEMENT CONCRETE OR • tv ASPHALT CONCRETE SIDEWALK OR PATH 9 9r6" (IHj PREM OLq ED JOINT FILLER (WHEN ADJACENT TO CEMENT CONCRETE SIDEWALK) CEMENT CONCRETE PEDESTRIAN CURB FACE OF CURB VARIES I TO 29", c— FACE OF CURB 1- OR R ROADWAY -7 - a '• In r r• ° r 1 914" 1 aw DUAL -FACED CEMENT CONCRETE TRAFFIC CURB T- (It'll R. v- ROADMY Vr0N R p- CEMENT CONCRETE la-(,P4 R I� HI CURB RAMP, LANDING, 1" (IN) OR DRIVEWAY R ENTRANCE VARIES FROM _ M" (IN) PREMOLDED JOINT FILLER CEMENT CONCRETE PEDESTRIAN CURB AT CURB RAMPS, LANDINGS, AND DRIVEWAY ENTRANCES FACE OF CURB 1" (IN) R. r ROADWAY 8 T14- CEMENT CONCRETE TRAFFIC CURB NOTE 1- See Standard Plan F-30.10 for Curb Expans0n and Contraction Joint spacing and see Standard Specification Sections &04 and 944 for additional requirements. FACE OF CURB T IW [IN) R, ROADWAY s• 81N' MOUNTABLE CEMENT CONCRETE TRAFFIC CURB �7 Barry, Ed May 6 2014 3:31 PM CEMENT CONCRETE CURBS STANDARD PLAN F-10.12-03 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Pasco a 2 hn 11 .� lu2014 1:25 PM 'dTATC D[90X UIgNpJI � wdrM;�. Set. G p. Tro n- 8" 1"R. P ^ 1"R• M TYPE (HOT MIX ASPHALT) TYPE 2 (HOT MIX ASPHALT) 2 1/2" 5" P m TYPE 3 (HOT MIX ASPHALT) 8" 2-V iV 1"R• II II iD # 3 BAR TYPE 4 (CEMENT CONCRETE) a- 1" � ^h II N II N II - II m a# 3 BAR TYPE 5 (CEMENT CONCRETE) 1°" P � m fl II II # 3 BAR TYPE 6 (CEMENT CONCRETE) 1z^ 1a _ D^ 12" yi BE EN JOINTS (TYP.) � I I CEMENT CONCRETE EXTRUDED CURB # 3 BARS (TYP.) SPACING OF ANCHOR BARS (FOR TYPES 4, 5, AND 6) NOTE JOINTS MAY BE FORMED DURING INSTALLATION USING A RIGID DIVIDER OR SAWCUT AFTER CONCRETE CURES TO MINIMUM STRENGTH. �O Jj 31805 S4 .off RCISTV, 1� �Sr�NAL �1yG EXPIRES AUGUST 26, 2007 EXTRUDED CURB STANDARD PLAN F-10.42-00 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Ken L. Smith 01-23-07 BTAIE DESIGN ENDINEFR DAIS A Wmhlnpmn Sfalft Depvlm� of T—walMion 1 '-------------- li 1 TOP VIEW INSIDE CORNER BLOCK TDP VIEW OUTSIDE CORNER BLOCK TOP VIEW 18" RADIUS BLOCK 1.ON R. 1 r r (IN) R. 93 REBAR - REQUIRED ONLY IN TANGENT BLOCK, MEN LENGTH EXCEEDS 30- (IN) (1 127 (IN) CUR. BOTH E140% - S EE STANDARD SPECIFICATION 9-47 r {IN) R. � d � 5" r t 1µ" 12" 1 46• TYPICAL OF ALL END VIEW INSIDE CORNER BLOCK 1S" (IN) RADIUS BLOCK f '!3` It (IN) OUTSIDE CORNER BLOCK 30" (IN) RADIUS BLOCK TOP VIEW 3D" RADIUS BLOCK ISOMETRIC VIEWS �nI n �.' Bakotich, Pasco /Q--0 Apr 22 2014 9:18 AM PRECAST SLOPED MOUNTABLE CURB STANDARD PLAN F-10.62.02 SHEET 1 OF 2 SHEETS APPROVED FOR PUBLICATION ti,h, P Apr 9:18 AM ,� srnre xaron vrowr�n we,Nlrglen smr. Gpe .'f T.rq. m k[ TOP VIEW INSIDE RADIUS BLOCK 1- (IN) k I 51 2- t 114• 12" SECTION 0 CURB RADIUS TABLE CURB RADIUS DIMENSION DIMENSION A B DIMENSM C 3' 112" 4' TO S 12" 1 la 9- B' 12" 1- SO' r 12' 710" 10 114' B' 16" 1 Ur 15 914" 7 16- 1- 16- 19 Is, 7AI" 161M- 11' TO 13' 1 B' 314' 16 W 14' TO 1S' 1 B" sm. 16 3W 1 V TO 17 24" 314" 221W 18' TO a 20 M. 22 &W 23' TO 2C 24- 10 2r 30'TO 3Y 3Ir 1a 21r 36TO41Y 37 M. 29 V4- 4V TO W 30' 11. 29112- OVER BY USE TANGENT BLACK, SEE SHEET 1 THIS TABLE LIST$ THE CALCULATED DIMENSIONS FOR CASTING BLOCKS SUITABLE FOR CONSTRUCTING VARIOUS CURB RADII. CURVED BLACKS, OR BLOCKS WTH DIFFERENT DIMENSIONS MAY BE ACCEPTABLE MATH PRIOR APPROVAL OF THE ENGINEER. m 1 I � 1 I 1 I 1 I I 1 1 [ 1 I 1 ! 1 I 1 I I E I 1 I 1 [ 1 1 [ ! 1 1 I 1 I [ 1 I [ 1 I [ 1 I m I TOP VIEW OUTSIDE RADIUS BLOCK INSIDE RADIUS BLOCK OUTSIDE RADIUS BLOCK ISOMETRIC VIEWS Sg 6F FA$dr� b 9 0�� qua 1 S T g�$9 ONAL !:;r4 2 2 Pasco Apr � Apr 22 014 9:20 AM PRECAST SLOPED MOUNTABLE CURB STANDARD PLAN F-10.62.02 SHEET 2 OF 2 SHEETS APPROVED FOR PUBLICATION Apr 22 2014 9:20 AM BTATE DESIaN ETgk R AIML W-hkM;m Sr D�perl .f Trcmpem6- NOTES A ( A) 1. The Detectable Warning Surface (DWS) shall extend the full width of the curb ramp, r DETECTABLE WARNING landing, or other roadway entrance as applicable. Exception: If the Manufacturer of I E MIN. MAX' CURB RAMP, LANDING, CUT- SURFACE (DWS) - the DWS requires a concrete border around the DWS, a variance of up to 2 inches ' A 1.60" 2.40" THROUGH OR WALKWAY SEE NOTE 3 on each side of the DWS is permitted. IS 0.65" — 2. The Detectable Warning Surface (DWS) shall be placed at the back of curb, with the A IS �- D C 0.45" 0.90" two leading corners of the DWS panel placed adjacent to the back of the curb, and with no more than a 2 inch gap between the DWS and the back of the curb measured D o.s" 1.40" BACK of NOTE - 2'- 0" MIN. - at the center of the DWS panel. Exception: If the Manufacturer of the selected DWS TRUNCATED DOME E 0.2" 0.2" SEE NOTE 2 TYP. OF ALL requires a concrete border around the DWS, a variance of up to 2 inches from the APPLICATIONS back of the curb is permitted measured at the leading corners of the DWS panel). SECTION O P ( g P ) TRUNCATED DOME SPACING SEE NOTE 3 SEE STANDARD SPECIFICATIONS 3. The rows of truncated domes shall be aligned to be perpendicular to the grade FOR COLOR OF SURFACE break at the back of curb. TRUNCATED DOME DETAILS MATCH TO WIDTH OF CURB RAMP 4. The rows of truncated domes shall be aligned to be parallel to the direction of travel. CURB AND GUTTER LANDING, CUT -THROUGH OR 5. If curb and gutter are not present, such as a shared -use path connection, the o < WALKWAY Detectable Warning Surface shall be placed at the pavement edge. DETECTABLE WARNING SURFACE DETAIL o0 6. See Standard Plans for sidewalk and curb ramp details. LANDING OFFSET CURB RAMP SEE NOTE 811'7 7. If a curb ramp is required, the location of the Detectable Warning Surface must be at LANDING the bottom of the ramp and within the required distance from the rail. WALKWAY WIDTH OF WALKWAY 8. When the grade break between the curb ramp and the landing is less than or equal to WALKWAY WALKWAY WIDTH OF CUT- 5 ft. from the back of curb at all points, place the Detectable Warning Surface on the THROUGH (TYP.) bottom of the curb ramp directly above the grade break. DETECTABLE WARNING SURFACE (DWS) - a ::: �J WIDTH OF CUT -THROUGH o SEE NOTE 4 CURB RAMP _ (TYP ) zi z BACK OF CURB w LL SINGLE DIRECTION CURB RAMP FLARE ;; FLARE 2'-0" 2' - 0" MIN. m (GRADE BREAK BETWEEN CURB AND MIN. LANDING 5 5 FT. FROM BACK OF CURB) (SEE NOTE 6) DETECTABLE WARNING DETECTABLE WARNING - o LANDING BACK OF CURB SURFACE (DWS) - SURFACE - w Y DIRECTION OF SEE NOTE 2 SEE NOTE 3 SEE NOTETE 3 3 o ¢ TRAVEL BACK OF CURB - w WIDTH OF CURB RAMP CURB RAMP m BACK OF CURB - SEE NOTE 2 SEE NOTE 2 WALKWAY � WIDTH OF PERPENDICULAR CURB RAMP ... NOTE 6) WALKWAY (SEE 2' - 0" MIN. ISLAND CUT -THROUGH WIDTH OF CURB RAMP, LANDING, OR WALKWAY DETE SURFACE ( P) - ®�T DETECTABLE WARNING SEE NOTE 3 "' ""' WAS l� SURFACE (DWS) - SEE NOTE 3 RPRQ OQ BACK OF CURB - BACK OF CURB- SEE NOTE 2 MEDIAN CUT -THROUGH _ SEE NOTE 2 Z o z_ SINGLE DIRECTION CURB RAMP DETECTABLE WARNING v WIDTH OF SHARED- 10 sv (GRADE BREAK BETWEEN CURB AND SURFACE (DWS) - _ USE PATH OR 0 +)'C 8680�Q0 ly'v LANDING > 5 FT. FROM BACK OF CURB) SEE NOTES 4 & 7 Z WALKVAAY (Typ.) Fs, GISTS Gl (SEE NOTE 6) JI e SIGNAL CURB RAMP CURB RAMP ��j WA;BACK LANDING WALKWAY WIDTH OF CUT -THROUGH ^�� _ Zeller 12'201Scoff SHARED -USE" Jul 1220164r25 PM (TYP.) PATH OR _ _ __ _ WALKWAY DETECTABLE WARNING ROUNDABOUT SPLITTER SURFACE ISLAND PAVEMENT SHOULDER EDGE STANDARD PLAN F-45.90-02 RAIL n SHEET 1 OF 1 SHEET DETECTABLE WARNING DETECTABLE RFACEWARNING APPROVED FOR PUBLICATION OF CURB - SURFACE (DWS) -SEE NOTE 3 WALKWAY _�LPATH OR SUSEE NOT(ES�4 & 5 % i iris zoii 26 PM SEE NOTE 2 WIDTH OF LANDING STNTE DESIGN ENGINEER PARALLEL CURB RAMP PEDESTRIAN RAILROAD CROSSING PLACEMENT GUIDELINES SHARED -USE PATH CONNECTIONAV Washington State Department of Transportation (SEE NOTE 6) DRAINAGE GRATE GRATE FRAME —. SEDIMENT AND DEBRIS \ a � % a % FILTERED WATER SECTION VIEW NOT TO SCALE MAX. - TRIM a 4 OVERFLOW BYPASS 0 v BELOW INLET GRATE DEVICE DRAINAGE GRATE - RECTANGULAR GRATE SHOWN BELOW INLET GRATE DEVICE NOTES 1. Size the Below Inlet Grate Device (BIGD) for the storm water structure it will service. 2. The BIGD shall have a built-in high -flow relief system (overflow bypass). 3. The retrieval system must allow removal of the BIGD without spilling the collected material. 4. Perform maintenance in accordance with Standard Specification B-01.3(15). ISOMETRIC VIEW RETRIEVAL SYSTEM (TYP.) OVERFLOW BYPASS (TYP.) STATE OF WASHINGTON REGISTERED LANDSCAPE ARCHITECT MARK W. MAURER CERTIFICATE NO. 000598 STORM DRAIN INLET PROTECTION STANDARD PLAN 1-40.20-00 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Pasco Bakodch III 09-20-07 STATE DESIGN ENDINEFR DATE Wcmhlnpmn Stab D@pamunt of TTmq)a"a bn 3- (IN )PEDESTRIAN PUSHBUTrON POST BRACKET ADAPTER (TYP.) ANCHOR FERRULE (TYP.) 3- (IN) PIPE CAP GROUNDING CONNECTION - SEE DETAIL 1 ,� EQUIPMENT GROUNDING ANCHOR CONDUCTOR COUPLING (TYP,) BRACKET (TYP•) SHIM (TYP.) - NO MORE THAN TWO PER COUPLING EXPLODED VIEW BREAKAWAY BASE CONNECTOR (SEE NOTE 1) TOP OF FOUNDATION 314" (IN) CHAMFER A x� FIELD DRILL AND TAP FOR 19-20 THREAD BOLT (TYP.) SIe" [IN] DIAMETER HOLE PEDESTRIAN PUSHBUTTON POST- 3" (IN) STEEL PIPE (SCHEDULE 40) 3- (IN) PEDESTRIAN PUSHBUTTON POST - BRACKET ADAPTER (TYP-) r BRACKET (TYP.) COUPLING BOLT (TYP.) 3- [IN] PEDESTRIAN PUSHBUTTON POST ANCHOR COUPLING[TYP-] EQUIPMENT GROUNDING SHIM TOP OF PAVED CONDUCTOR r (iYP.] SURFACE J BRACKET ADAPTER -i�-. BRACKET(TYP.) - of • PREMOLDED COUPLING BOLT JL11NT FILLER (TYP ] - - COMMERCIAL 5 •"ii • CONCRETE � i • - ANCHOR FERRULE SHIM (TYP.) II s (TYP.) ANCHOR FERRULE (TYP.) 1-(IN)DIAM CONDUIT ETER ELECTRICAL J 1-[IN]UTAM. ELECTRICAL R- IT FOUNDATION DETAIL V THREAD TOP OF POET k== _ f r, i rl ri ri G i 51J Sri it cl -4 "I Ir r!— tti n I POST DETAIL DETAIL (�) NOTES 1. See Standard Specification 8-06.16 For Breakaway Base Connection details- Dimensions For the parts Used to assemble the base Connections are intentionally not shown. Base connections are patented manufactured products that are in compliance with NCHRP 350 crash test criteria- The Breakaway Base Connection details are only shown on this plan to illustrate how parts are assembled. 2, See Standard Plan J-20.26 for Accessible Pedestrian Pushbutton details- 3. Secure conductor in adjacent Junction Box per detail in Standard Plan J-28.70- 4. Where shown in the plans, install plaque (R1D32P) "PUSH BUTTON FOR 2 SECONDS FOR EXTRA CROSSING TIME" above the Accessible Pedestrian Signal (APS) assembly. Add 14" (In) to post height to accommodate plaque and leave a 2" (in) space between signs- S. Mounting distances vary between manufacturers- See manufacturers recommendations for mounting information. 8. Junction Box serving the Standard shall preferably be located 5' - 0" (10' - 0" Max.) from the Standard. PIPE CAP 1Ia r'� STAINLESS STEEL F TOP OF POST FLAT WASHER (IYP.) 114" (IN) x 1 114" [IN] LONG STAINLESS STEEL THREADED STUD ap - 7 POST WALL THREE 114" (INJ STAINLESS � EQUIPMENT GROUNDING CONDUCTOR AND FULL STEEL HEX NUTS CIRCLE CRIMP -ON CONNECTOR - CRIMPED WITH A MANUFACTURERS RECOMMENDED CRIMPER GROUNDING CONNECTION DETAIL * WELD STUD TO POLE WALL TO MAXIMUM EXTENT POSSIBLE - V2- [IN] MINIMUM WELD CONFIGURATIONS VARY AMONG DIFFERENT MANUFACTURERS (SHOWN EXPLODED FOR CLARITY) EDGE OF SHOULDER TOP OF FOUNDATION ANCHOR COU PLING (TYP.) CONDUIT COUPLING - INSTALL FLUSH WITH TOP OF FOUNDATION - (DO NOT GLUE PVC STUB -OUT) EDGE LINE f ,L e.ier,ra Grp•" 1un2620144:25PM ACCESSIBLE BREAKAWAY PEDESTRIAN PUSHBUTTON (PPB)POST STANDARD PLAN J-20.15-03 SHEET t OF 1 SHEET APPROVED FOR PUBLICATION Jun 30 2014 3:11 PM e iwr¢�pN EHWNEER w•�Irrp•¢ srw o.P� d rror.p•aml¢¢ 1W WEEP HOLE J BRONZE COLLAR AND TERMINAL COMPARTMENT O IMSA 20•1 70 414 CABLE FROM CONTROLLER h (SEE NOTE 3) x DOUBLE PEDESTRIAN SIGNAL WIRING DETAIL (TYPE C MOUNTING SHOWN) FOR SIGNAL HEAD MOUNTING DETAILS; SEE STANDARD PLAN "120.18 1 NOTES 'ERMINAL BLOCK 1. See Standard Plan J-21.10 for Signal Standard Foundation with Fixed Base zz= and Slip Base details. 2. See Standard Specification 9-29.3 for Cable Conductor requirements. 3. 4. Install heat shrink caps on all spare conductors not terminated on a terminal strip. Supplemental grounding conductor shall be non4nsulated #4 AWG stranded capper and shall be clamped to vertical rebar with a connector suitable for use embedded in concrete: provide 3' - 0" min. slack. Attach to pole grounding stud with a full circle crimp -on Cannector {crimped with manufacturer's recommended crimper}. 5. Equipment grounding conductor shall attach to grounding stud with a full circle crimp -on connector (crimped with a man ufacurer's recommended crimper). IW WEEP HOLE SLIPFITTER - OFFSET TOP MOUNT. - PLACE OFFSET TO FRONT OF POLE, DRILL TO SEAT SET SCREWS - IMSA 2NI 5C 414 CABLE PEDESTRIAN SIGNAL WIRING DETAIL IMSA 2D•13C 414 CABLE [TYPE DMOUNTING SHOWN] MSA 23-1 7C OR 5C #14 CABLE - ACCESSIBLE PEDESTRIAN TO SIGNAL DISPLAY (SEE CONTRACT PUSHBUTTON DETAILS - PLANS FOR WIRE SIZE AND CIUANTITI ES) SEE STANDARD PLAN "L20.28 zc(sH]calloucrDR -FROM CONTROLLER INSUUNER SLEEVE ACCESSIBLE PEDESTRIAN PUSHBUTTON WRING DETAIL I MSA 20•1 7C OR 5C #14 CABLE - TO SIGNAL DISPLAY (SEE CONTRACT PLANS FOR STAINLESS STEEL WIRE SIZE AND QUANTITIES] 2C (SH) CONDUCTOR -� TO PUSHBUTTON WASHERS {TYP.) [SEE CONTRACT PLANS FOR gl1ANTTfIE$] 118 114" DIAMETER - 1" LONG HAND HOLE POLE WALL STAINLESS STEEL STUDEQUIPMENT GROUNDING -CONDUCTOR - SEE NOTE 5 LEVELING NUT (1'!P.) a1S" STAINLESS AEV STEEL REINFORCING STEEL NUT BAR STAINLESS STEEL NUT SUPPLEMENTAL GROUNDING CONDUCTOR - SEE NOTE d FULL CIRCLE CRIMP -ON EQUIPMENT GROUNDING CONNECTOR [fYP } CONDUIT COUPLING ^INSTALL FLUSH WITH TOP OF FOUNDATION CONDUCTOR - SEE NOTE 5 (DO NOT GLUE PVC STLIBOUT) GROUNDING CONNECTION f DETAIL SUPPLEMENTA ELECTRICAL CONDUIT - SEE CONDUCTOR -SEE NOTE 4— CONTRACT PLAN FOR DIAMETER CONFIGURATIONS VARY RMONG DIFFERENT MANUFACTURERS (SHOWN EXPLODED FOR CLARITY) FOUNDATION WIRING DETAIL SC PEDESTRIAN HEAD TERMINATIONS TERMINAL NUMBER COLOR CODE USE 7 * 1 R DON'T WALK DISPLAY 7 * 2 G WALK DISPLAY 7 * 8 W NEUTRAL CONDUCTOR 7 * 8 B SPARE CONDUCTOR T * 7 1 O SPARE pOINDUCTOR - Arb-bLX IAI t0 MI1ASt NUNItIbF4 7C PEDESTRIAN H FAD TE RMI NATIO NS TERMINAL NUMBER COLOR CODE USE 7 * 1 7 * 2 R CONT WALK DISPLAY O WALK DISPLAY 7 * 8 W NEUTRAL CONDUCTOR 7 sr 8 B SPARE CONDUCTOR 7 * 7 O DONT WALK DISPLAY 7 * 2 BL WALK DISPLAY 7 * S WB 1NEUTRAL CONDUCTOR Ye Ile -0 �tz ] S^ fs10NAL g�fl fl M1 PEDESTRIAN SIGNAL STANDARD TYPE PS) ELECTRICAL DETAIL STANDARD PLAN J-20.20-02 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Pasco 8akotich HI &2&13 MTi WA �, TED NBi6M1EEk WachkgMn 51 e.p� OF T—pennon ACCESSIBI PEDESTRU PUSHBUTTC CAPS) ASSEUR KEY 7 FACE PLATE 2 114-20. 318' LONG STAINLESS STEEL SCREW S 114-20 STAINLESS STEEL SCREWS 4 PUSHBUTTON FRAME ADAPTER 5 114-20 STAINLESS STEEL BOLT WI WASHER AND LOCK WASHER PUSHBUTTON STATION 7 DRILL AND TAP SHAFT FOR 114" DU1M. BOLT B OR I LL AND TAP SHAFT FOR W WIRE GUIDE HOLE - ADD INSU LI NER ATTACH SIGN TO ADAPTER - 114.20. 318' STAI N LESS STEEL SCREWS (TYP.) ATTACH ADAPTER TO PUSH- BUTTON STATION - 114' DIAM. COUNTERSUNK HOLE. 3M" LONG FLAT HEAD SCREWS (TYP.) PEDESTRIAN PUSHBUTTON FRAME ADAPTER PEDESTRIAN PUSHBUTTON INSTRUCTIONAL SIGN ACCESSIBLE PEDESTRIAN SIGNAL (ASP) ASSEMBLY METAL POLE INSTALLATION PPS-M ISOMETRIC VIEW [METAL POLE SHOWN] ACCESSIBLE PEDESTRIAN PUSHBUTTON (PPB) DETAILS STANDARD PLAN J-20.26-01 SHEET 1 OF 2 SHEETS APPROVED FOR PUBLICATION Pasco Bakotich H1 7/12/12 arnre rxsaf anueen wa jWWedFgbn sfaft o.pm m 9 TnnpeneNm WOOD POLE INSTALLATION ALTERNATIVE 1 PPB-W (ACCESSIBLE PEDESTRIAN PUSHBUTTON -TEMPORARY TIMBER STRAIN POLE) KEY 1 FACE PLATE 2 114-20. AT LONG STAINLESS STEEL SCREW 3 77d-20 STAINLESS STEEL SCREWS 4 PLhSHBLRTON FRAME ADAPTER 15 LAG BOLT WITH WASHER B PUSHBUTTON STATION 7 CONDUIT DIAMETER + IWHOLE THRU POLE S CONDULET 9 V4'OONDUIT LIQUID-TITE FLEX CONDUIT 7 ONE PIECE TWO HOLE CLAMP 2 LAG BOLT INSULI NER SLEEVE INSTALL FITTING WITH NYLON WASHER ON OUTSIDE OF HOUSl NG - SEAL WITH SILICONE AFTER UNIT 1.5 FULLY ASSEMBLED CO UNTERBORE - DIAMETER TO FIT CON DU LET PRE -DRILL (3) 714' WEEP HOLES IN BOTTOM RADIUS OF CONDUIT DRIP LOOP. REAM HOLES WITH DRILL BIT TO ELIMINATE BURRS ACCESSIBLE PEDESTRIAN SIGNAL (ASP) ASSEMBLY WOOD POLE INSTALLATION ALTERNATIVE 2 PPB-W (ACCESSIBLE PEDESTRIAN PUSHBUTTON -TEMPORARY TIMBER STRAIN POLE) TEMPORARY TIMBER POLE WOOD POLE INSTALLATION ALTERNATIVE 3 PPB-W (ACCESSIBLE PEDESTRIAN PUSHBUTTON -TEMPORARY TIMBER POLP A&Awko 4E 30S$ph, xapR q� 4g of F"B� H i �a o Q7 p Y 1DNAL 8 ACCESSIBLE PEDESTRIAN PUSHBUTTON [PPB) DETAILS STANDARD PLAN J-20.26-01 SHEET 2 OF 2 SHEETS APPROVED FOR PUBLICATION Pasco BakoVch 1N 711V12 STAM�o M mm Aw jW W..I.r..;N Sx o.pn. .f Troy p-1.6- KEY LO W 3 1 CENTER PIPE SIDE MOUNT [ 2 CNASE NIPPLE TYPE A-PEDESTRN 3 NIPPLE 4 IA TYPE H • VEHICLE ® SERRATED ELBOW SERRAEDTOR FLANGED ELBOW 8 REAMED TEE WITH SET SCREW 7 REAMED ELBOW PITH SET SCREW B BRONZE TERMINAL COMPARTMENT WITH: • GASKETED COVER •FASTENERS ■WIRE LEADS • MOUNTING SADDLE FOR SIDE MOUNTS ON ROUNarrAPERED POLES! OMIT SADDLE ON MULTI -SIDED POLES ■ 114' (IN) CLAM. DRAIN HOLE • I2-POSITION TERMINAL STRIP •WyIREWAY FOR SIDE MOUNTS 0 BRONZE COLLAR - 4 114- (IN) I.D. OFFSET OPENING WSET SCREWS 10 ORNAMENT CAP 11 NEOPRENE CASKET 1 WASHER $ CONDUIT LOCKNUT 1 TYPE E HINGE CLAMSHELL MOUNT - LEFT OR RIGHT, SEE CONTRACT 15 FASTENER WITH SPACER - • 112' pN) LAG SCREWS ON WOOD POLE i • 1rr fIM BOLTS TAPPED TO METAL POLE 1 FLATHEAD SOCKET BOLT 1 10 (IN) INSERT HOLE FOR EXTERNAL WIRE ENTRANCE (REQUIRED ON TIMBER POLE MOUNTING ONLY) 18 TERMINAL BLOCK AND PHENOLIC TAG 19 INSULINER - 1-[INj MIN- DIAM. HOLE RSIGNAL HEAD VdTH BACKPuTE FIELD DRILL POLE AND INSERT AN INSULINER OR SIMILAR DEVICE TO PROTECT CONDUCTORS TOP MOUNT ®SIMILAR TO ® NTH BRONZE INTEGRAL COLLAR TYPE D - PEDESTRULN - OFFSET BRONZE COLLAR TO FRONT (�p 1Y1" (IN) DIAM- X T (IN) LONG BOLT 1MTN WASHER OR VEHICLE (SHOWN) - OFFSET BRONZE COLLAR TO BACK ELEVATION TYPE E MOUNTING DETAILS V i i TOP MOUNT TYPE C - PEDESTRIAN TYPE F- VEHICLE PEDESTRIAN HEAD SIDE MOUNT (LEFT SIDE SHOWN) TYPE E - COUNTDOWN LED PEDESTRIAN HEAD NOTES 1- See Contract for head type, mounting height, and orientation. 2- All nipples, fittings, and center pipes shall be 1 112' (in) diameter. 3- Install neoprene gasket inside head when flanged elbows are Supplied. 4. Extend wire sheath a minimum of 1" (in) inside all signal and sign housings and terminal compartments. 5- Apply bead of silicone to the serrated ring and around the perimeter of all top openings prior to installation of fittings. 6- See Standard Specification 9-29.16 for backplate requirements. Where required, prismatic sheeting shall be applied in accordance with the manufacturer's recommendations - The application surface of the backplate shall be cleaned, degreased with isopropyl alcohol, and dried prior to application of the sheeting. 7- Drill a 114' (in) drain hole in the bottom of each Signal display assembly, and one in the bottom of each pedestrian head. When signal display assembly is mounted horizontally, drill a 114' (in) drain hole at the lowest point of each section of the signal assembly. 73ailey, Ted Jul 8 2015 3:09 PM SIGNAL H"D MOUNTIN6: DETAILS ^- POLE AND POST TOP MOUNTINGS STANDARD PLAN J-75.10.02 SHEET 1 OF 1 SHEET APPROVED FOR�IIBUGAT�N f /! arpenter, e Jul 10 2015 7:19 AM grA1E9F810N ENOINBER w.&10.0— sue. G p. - f T. ® SfARr CROSSING VtlY91u DONTRfMr ®= N81310d HY9O bbtl ®RME RBdVNING To ROWWnp ® 0G97TCROSS PU� To cNo3s ELEVATION VIEW 1.5" DIAMETER ST THREADEDI STEEL ELBOW - THREADED ONE END ONLY - STAINLESS STEEL SET SCREW ON REAMED END APS PUSHBUTTON NOT INCLUDED ® half (SHOWN FOR REFERENCE ONLY) - 1kk''..TT1I HARDWARE AND INSTALLATION Yy„Pq PER MANUFACTURERS RECOMMENDATION TO 1.5" DIAMETER STEEL TUBE - THREADED ONE END ONLY ELEVATION VIEW WITH APS INSTALLED APS PPB EXTENSION DETAIL STEEL ELBOW - THREADED BOTH ENDS CURVED BOLT -ON PLATE WITH C. GUIDE (BRONZE) ( SIGNAL POLE 1/2" (IN) - 13NC x 2" (IN) LONG Ss HEX HEAD BOLT AND S.S LOCK WASHER (TYP.) :R STEEL TUBE - OTH ENDS EXPLODED VIEW NOTE See Standard Specification Section 9-29.17 for additional material requirements, including painting of all pipes, elbows, and hub plates. Washington State Department of Transportation IS-2 ACCESSIBLE PEDESTRIAN SYSTEM (APS) ASSEMBLY (TYP.)- SEE STANDARD PLAN J-20.11 FOR DETAILS (SEE DESIGNER NOTE 8) ACCESSIBLE PEDESTRIAN SYSTEM (APS)ASSEMBLY - SEE STANDARD PLAN J-20.11 FOR DETAILS (SEE DESIGNER NOTE 8) VARIES ACCESSIBLE PEDESTRIAN SYSTEM (APS) 10 MAT(, ASSEMBLY (TYP.) - SEE STANDARD (SEE NOTE i) PLAN J-20.10 FOR DETAILS (SEE DESIGNER NOTE 8) SIDEWALK - SEE STANDARD PLAN F-30.10 FOR DETAILS PARALLEL CURB RAMP (TYP.)- SEE STANDARD PLAN F-40.12 FOR DETAILS SIDEWALK - SEE STANDARD PLAN F-30.10 FOR DETAILS __ L CROSSWALK LAYOUT \ (TYP.)- SEE STANDARD PLAN M.15.10 FOR DETAILS DETECTABLE WARNING SURFACE (TYP.) - SEE STANDARD PLAN F-45.10 FOR DETAILS PARALLEL CURB RAMP 50' (FT) RADIUS SHOWN SIDEWALK - SEE STANDARD PLAN F-30.10 FOR DETAILS PARALLEL CURB RAMP (TYP.) - SEE STANDARD PLAN F40.12 FOR DETAILS DETECTABLE WARNING SURFACE (TYP.) - SEE STANDARD PLAN F-45.10 FOR DETAILS PERPENDICULAR CURB RAMP (TYP.)- SEE STANDARD PLAN F-40.15 FOR DETAILS 4 CROSSWALK LAYOUT (TYP.)- SEE STANDARD PLAN M-15.10 FOR DETAILS PERPENDICULAR CURB RAMP 35' (FT) RADIUS SHOWN SIDEWALK - SEE STANDARD PLAN F-30.10 FOR DETAILS PERPENDICULAR CURB RAMP (TYP.) - SEE STANDARD PLAN F-40.15 FOR DETAILS ACCESSIBLE PEDESTRIAN SYSTEM (APS) ASSEMBLY (TYP.)- SEE STANDARD PLAN J-20.10 FOR DETAILS (SEE DESIGNER NOTE 8) � I DETECTABLE WARNING SURFACE (TYP.)- r SEE STANDARD PLAN F45.10 FOR DETAILS 5' MAX. _ 'L PARALLEL CURB RAMP 25' (FT) RADIUS SHOWN NOTES 1. ALIGN THE FRONT FACE OF THE APS ASSEMBLY PARALLEL WITH THE CROSSWALK. 2. ACCESSIBLE PEDESTRIAN PUSHBUTTON ASSEMBLIES SHALL HAVE BOTH AUDIBLE AND VIBROTACTILE WALK INDICATORS, WITH THE VIBROTACTILE WALK INDICATION PROVIDED BY A TACTILE ARROW ON THE PUSHBUTTON THAT VIBRATES DURING THE WALK INTERVAL. 3. THE TACTILE ARROW SHALL HAVE A HIGH VISUAL CONTRAST (LIGHT ON DARK OR DARK ON LIGHT)AND BE ALIGNED PARALLEL TO THE DIRECTION OF TRAVEL ON THE ASSOCIATED CROSSWALK. 4. WHEN ACCESSIBLE PEDESTRIAN PUSHBUTTONS ON A CORNER ARE SEPARATED BY 10' (FT) OR MORE, THE AUDIBLE WALK INDICATION SHALL BE A PERCUSSIVE TONE WITH EIGHT TO TEN TICKS PER SECOND. IF TWO ACCESSIBLE PEDESTRIAN PUSHBUTTONS ON A CORNER ARE INSTALLED LESS THAN 10'(FT)APART (I.E. ON THE SAME POLE), EACH ACCESSIBLE PEDESTRIAN PUSHBUTTON SHALL HAVE A PUSHBUTTON LOCATOR TONE, TACTILE ARROW, SPEECH WALK MESSAGE FOR THE WALKING PERSON (SYMBOLIZING WALK) INDICATION, AND SPEECH PUSHBUTTON INFORMATION MESSAGE. SEE THE MUTCD FOR SPEECH MESSAGE STANDARDS. 5. WHEN AN EXTENDED PUSHBUTTON PRESS IS USED TO PROVIDE ANY ADDITIONAL FEATURES (SUCH AS ADDITIONAL CROSSING TIME), THEN THE TACTILE ARROW SHALL BE MARKED AT ITS CENTER WITH THREE BRAILLE DOTS FORMING AN EQUILATERAL TRIANGLE. 6. WHEN ADDITIONAL CROSSING TIME IT PROVIDED BY AN EXTENDED PUSHBUTTON PRESS,A "PUSH BUTTON FOR 2 SECONDS FOR EXTRA CROSSING TIME" SIGN (R10.32P) SHALL BE INSTALLED ADJACENT TO OR INTEGRAL WITH THE ACCESSIBLE PEDESTRIAN PUSHBUTTON ASSEMBLY. PROVIDE 2" (IN) SPACING BETWEEN EDGES OF SIGNS. DESIGNER NOTE: NOTES 7 AND 8 ARE NOT INTENDED FOR INCLUSION IN THE CONTRACT DOCUMENTS (LEVEL 22). 7. CONTACT THE H.Q. TRAFFIC OFFICE FOR SIDEWALKS WIDER THAN 10'(FT). 8. PLACE PEDESTRIAN PUSHBUTTONS WITHIN 10'(FT)FROM CENTER OF CURB RAMP (MEASURED FROM THE FRONT OF THE CURB)OR SHOULDER PER MUTCD SECTION 4E.08. DOCUMENTATION IS REQUIRED IF 10'(FT)CANNOT BE ACHIEVED. DETECTABLE WARNING SURFACE (TYP.)- SEE STANDARD PLAN F-45.10 FOR DETAILS CROSSWALK LAYOUT (TYP.) - SEE STANDARD PLAN M-15.10 FOR DETAILS L PERPENDICULAR CURB RAMP 35' (FT) RADIUS SHOWN Amok wIi Washington State Department of Transportation LEGEND IS ACCESSIBLE PEDESTRIAN SIGNAL (APS)ASSEMBLY q HOV LANE LAYOUT 2'_B" T-T- 2" u _�, u � MARIONG AREA 11.40 SQ.FT. HOV LANE SYMBOL NOTE When Specified in the Contract Plans, the HOV Symbol Marking shall be installed with an offset of 1 foot max. from the lane centerline. oV WAS&,, hill Jill, IL9�``� �O� 25335 �9 S4 g $ �A 01 S TL4 �SrONAL EXPIRES AUGUST 9, 2007 HIGH OCCUPANCY VEHICLE (HOV) LANE SYMBOL LAYOUT STANDARD PLAN M-7.50-01 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Ken L. Smith 01-30-07 BTAIE DESIGN ENDINEFR DATE 411106 Wmhingm Sf D.pml of Tnnfpa"Im I, LANE LINE BICYCLE LANE SYMBOL LAYOUT TOTAL MARKING AREA 10.27 SO. FT. KEY NOTES (1) Bid Item "Bicycle Lane Symbol" includes Bike Lane Arrow and Bike Rider Symbol. 2' (ft) x 6' (ft) White Bike Lane Arrow. Bike Rider Symbol. MARKING AREA GRID IS 1" (IN) SQUARE 6.02 SQ. FT. BIKE RIDER SYMBOL DETAIL iiQHY I p@ WASg7�,� �0.P� 36103 03 MARKING AREA 6 ssIONAL 4.25 SQ. FT. Walsh, Brian Jun 24 2014 1:53 PM BIKE LANE ARROW BICYCLE LANE SYMBOL DETAIL LAYOUT STANDARD PLAN M-9.50-02 SHEET 1 OF 1 SHEET GENERAL NOTE APPROVED FOR PUBLICATION Bakoach, Pauo See Contract for location and material requirements. !J'F7..+ lwzazota,:,zpM STATE DESIGN ENGINEER Washington State Department of Transportation O LL v TRAFFIC LANE VEHICLE WHEEL PATH 3'-3" 3'-3" IN. I MIN. LANE I D 3'I 3'-3° MIN. MIN. HIGH-SPEED APPLICATION TRAFFIC LANE VEHICLE WHEEL PATH 3'- MIN' 3" MIN. LANE D D 3'_3-IT-3" MIN. MIN. LOW -SPEED APPLICATION x w b W � J O z N x�u b w mJ EDGE LINE 1 Z EDGE LINE TRAFFIC LANE VEHICLE WHEEL PATH I I. I HIGHSPEED APPLICATION EDGE LINE MAX. HIGH-SPEED APPLICATION TRAFFIC LANE VEHICLE WHEEL PATH 3'-3"I 3'-3" MIN. MIN. LSE EDGE LINE b m z fw/J AIMto Eli EDGE LINE r-10" MAX. LOW -SPEED APPLICATION NOTE 1. Typically, four times the letter or numeral height - minimum, up to ten times - maximum, or according to Plans. TRAFFIC LANE VEHICLE WHEEL PATH I LANE I 0 LOW -SPEED APPLICATION C7 y k0 � J z w w rn t=_7 x p ba ro (;. 3 EDGE LINE rjF WASy�c��'� S a Jill, _ q �O 3 29115 FCI S T V, �srDNAL ECG g�g E �g� TRAFFIC LETTER AND NUMERAL APPLICATIONS STANDARD PLAN M-80.10-01 SHEET 1 OF 2 SHEETS APPROVED FOR PUBLICATION Pasco BakotlCh 111 06-03-11 _ SIATE DE8IGN ENGINEER DALE Washington StaN D"a� wH *IT a Pori 0 O y VEHICLE WHEEL PATH VEHICLE WHEEL PATH I 3'-3" 3'-3" MIN. MIN. MIN. MIN. LANE i LANE LANE LINE Fw F J EDGE LINE TRAFFIC LANE VEHICLE WHEEL PATH 0_2 00 LANE EDGE LINE LANE TRAFFIC VEHICLE LANE WHEEi PATH VEHICLE WHEEL PATH L y O = w b I � J O 3,_3"I3._3" MIN. MIN. LANE z 31 - 3" 1 3' _ V. w IN. MIN. w LANE D �y D a 3'-3" 3'-V. 3'-3"' 3'-3" MIN. MIN. EDGE MIN. MIN. C LINE HIGHSPEED APPLICATION LOW -SPEED APPLICATION EDGE LINE TRAFFIC LANE VEHICLE PATH �jWHEEL YLJ Y% x� m I LANE o Z w 3'-3" 3'-3" rn MIN. MIN. x EDGE LINE HIGH-SPEED APPLICATION TRAFFIC LANE VEHICLE WHEEi PATH LANE HIGH-SPEED APPLICATION TRAFFIC LANE VEHICLE WHEEL PATH LANE i HIGH-SPEED APPLICATION EDGE LINE x N =W a� W W N A� 00 29115 ww i FoiSTBR4' �"'IONAL 02 TRAFFIC LETTER AND o NUMERAL APPLICATIONS a a, wO STANDARD PLAN M-80.10-01 w > w SHEET OF SHEETS w APPROVED FOR PUBLICATION Pasco BakotlCh 111 06-03-11 _ EDGE LINE -' "FNG R ogre Aok T—hinpron SNm D.Pam wd or Traly r"m ®�®DOE WASfj/,I•A-A�i $ Jill, b� b �O 25335 F01 S T ER4' ti� �srONAL y ECG EXPIRES AUGUST 91 2009 TEN FOOT HIGH LETTERS SHOWN ON A FIVE- INCH SQUARE GRID FOR USE ON ROADWAYS WITH A POSTED SPEED OF 40 MPH OR LESS TRAFFIC LETTERS AND NUMERALS (LOW SPEED ROADWAYS) STANDARD PLAN M-80.30-00 SHEET 1 OF 1 SHEET APPROVED FOR PUBLICATION Pasco Bakodch 111 06-10-08 STALE DESIGN ENGINEER DATE pWmhinpbn sNm wram^.m a Twlspor"m 212th St. Preservation/Holcomb A - 3 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 TRAFFIC CONTROL PLANS R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 1 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEFT TWO LANES CLOSED AHEAD W20-501 ROAD WORK AHEAD W20-1 W4-2RNO SHEETS WEST OF HEREMATCH SHEET 2R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES R3-5R ONLY 18” x 24” 350’350’350’ 295’ 590’ 295’DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD Pacific Coast Express 6835 S 212th St Kent, WA 98032 W4-2R WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 2 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 SPEED LIMIT 40 DRIVEWAYLEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”MATCH SHEET 3MATCH SHEET 1ROAD WORK AHEAD W20-1 ROAD WORK AHEAD W20-1 METRO STOP UNAFFECTED METRO STOP UNAFFECTED NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED INTERURBAN TRAIL ACCESS MAINTAINED AT ALL TIMES. CONTRACTOR MAY CLOSE HALF THE CROSSWALK FOR CONSTRUCTION THEN FLIP WORK AREA TO OPPOSITE SIDE OF TRAIL TO COMPLETE WORKNO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE KEEP RIGHT R4-7 18” x 24”DRIVEWAYDRIVEWAYKEEP RIGHT R4-7 18” x 24” KEEP RIGHT R4-7 18” x 24” WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours.72ND AVE S72ND AVE SNO TURN RESTRICTIONS NO TURN RESTRICTIONS 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 3 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: METRO STOP UNAFFECTED METRO STOP UNAFFECTED NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours.MATCH SHEET 2MATCH SHEET 4LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD W4-2R KEEP RIGHT R4-7 18” x 24” ROAD WORK AHEAD W20-1 SPEED LIMIT 40 295’ R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYNO TURN RESTRICTIONS NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 4 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. SPEED LIMIT 40 LEFT TWO LANES CLOSED AHEAD W20-501 ROAD WORK AHEAD W20-1W4-2R LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD 295’ PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES MATCH SHEET 3NO SHEETS EAST OF HERE350’350’350’ ROAD WORK AHEAD W20-1 PCMS CITY OF KENT SHALL DETERMINE MESSAGE DRIVEWAYNO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE NO TURN RESTRICTIONS NO TURN RESTRICTIONS 48” x 24” G20-2 END ROAD WORK (OPTIONAL) KEEP RIGHT R4-7 18” x 24” KEEP RIGHT R4-7 18” x 24” R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE R3-5R ONLY 18” x 24” PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES R3-5R ONLY 18” x 24” 295’DRIVEWAY 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR RWORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 5 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEFT TWO LANES CLOSED AHEAD W20-501 ROAD WORK AHEAD W20-1 W4-2R 350’ 350’350’NO SHEETS WEST OF HEREMATCH SHEET 6ROAD WORK AHEAD W20-1 ROAD WORK AHEAD W20-1 W4-2R KEEP RIGHT R4-7 18” x 24”DRIVEWAYDRIVEWAYNO TURN RESTRICTIONS R3-5R ONLY 18” x 24”DRIVEWAYNO TURN RESTRICTIONS NO TURN RESTRICTIONS M4-9 48” x 36” DETOUR PLAQUE M4-9 48” x 36” DETOUR TO: EB 212TH PLAQUE REFER TO SHEET 33 DETOUR (B) FOR DETAILS REFER TO SHEET 33 DETOUR (A) FOR DETAILS M4-9 48” x 36” DETOUR TO: WB 212THPLAQUE TO: WB 212TH R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 6 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 R3-5R ONLY 18” x 24”R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYKEEP RIGHT R4-7 18” x 24”MATCH SHEET 5NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED MATCH SHEET 728” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE 295’ INTERURBAN TRAIL MAINTAINED AT ALL TIMES NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 7 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYNO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES:MATCH SHEET 6MATCH SHEET 8LEFT TURN LANE CLOSED AHEAD ROAD WORK AHEAD W20-1 W2-401 LEFT TURN LANE CLOSED AHEAD ROAD WORK AHEAD W20-1 W2-401 R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” CROSSWALK CLOSED 36” x 24” R9-3XC CROSSWALK CLOSED 36” x 24” R9-3XCDRIVEWAYDRIVEWAY DRIVEWAYKEEP RIGHT R4-7 18” x 24” METRO STOP UNAFFECTED METRO STOP UNAFFECTED METRO STOP UNAFFECTED 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE W2-401 M4-9 48” x 36” DETOUR TO: EB 212THPLAQUE REFER TO SHEET 33 DETOUR (B) FOR DETAILS R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE 28” REFL. CONE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 8 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 R3-5R ONLY 18” x 24” NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: LEFT TWO LANES CLOSED AHEAD W20-501 ROAD WORK AHEAD W20-1W4-2R NO SHEETS EAST OF HERE350’350’350’ LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD PCMS CITY OF KENT SHALL DETERMINE MESSAGE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES SPEED LIMIT 40 295’295’590’DRIVEWAYMATCH SHEET 7NO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE 48” x 24” G20-2 END ROAD WORK (OPTIONAL) W4-2R R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE R3-5R ONLY 18” x 24” PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR RWORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. LEFT TWO LANES CLOSED AHEAD W20-501 W4-2RNO SHEETS WEST OF HEREDRIVEWAYWASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 9 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 ROAD WORK AHEAD W20-1 350’350’350’ 295’ 295’ 590’ R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYDRIVEWAYW4-2R MATCH SHEET 10METRO STOP UNAFFECTED R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 ROAD WORK AHEAD W20-1 NO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE MATCH SHEET 11DRIVEWAYR3-5R ONLY 18” x 24” TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 10 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES:MATCH SHEET 9NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED KEEP RIGHT R4-7 18” x 24” NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSEDDRIVEWAYR3-5R ONLY 18” x 24”MATCH SHEET 11ROAD WORK AHEAD W20-1 METRO STOP UNAFFECTED 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE KEEP RIGHT R4-7 18” x 24”KEEP RIGHT R4-7 18” x 24” R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 DRIVEWAYR3-5R ONLY 18” x 24” TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 11 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED MATCH SHEET 12METRO STOP UNAFFECTED DRIVEWAYDRIVEWAYR3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSEDMATCH SHEET 1028” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE DRIVEWAYTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 12 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED R3-5R ONLY 18” x 24” NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSEDDRIVEWAYR3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYDRIVEWAYR3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”MATCH SHEET 13MATCH SHEET 11 R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SDRIVEWAYTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 13 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 R3-5R ONLY 18” x 24” 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 350’ 295’MATCH SHEET 14590’ TANGENT CON’T FROM SHEET 14 MATCH SHEET 12METRO STOP UNAFFECTED BE PREPARED TO STOP W20-7b ROAD WORK AHEAD W20-18W20-7a 350’ 350’ POLICE POLICE 350’ BE PREPARED TO STOPW20-7b ROAD WORK AHEAD W20-1 W20-7a 350’ 350’ W20-7a R3-5R ONLY 18” x 24”DRIVEWAYW20-7a 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE SPEED LIMIT 40 R3-5R ONLY 18” x 24”DRIVEWAYSIGNAL SHALL FLASH RED-ALL DIRECTIONS UPO SHALL COUNTERMAND SIGNAL (REQUIRES OFF-DUTY LAW ENFORCEMENT OFFICER) UPO’S SHALL CONTROL ALL TRAFFIC MOVEMENTS WITHIN INTERSECTION LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD8 CONE TOP SIGN (FACING WEST) R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 28” REFL. CONE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 14 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD PCMS CITY OF KENT SHALL DETERMINE MESSAGE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES SPEED LIMIT 40 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEFT TWO LANES CLOSED AHEAD W20-501 ROAD WORK AHEAD W20-1W4-2R 350’350’350’295’ TANGENT CON’T ON SHEET 14 590’ W4-2R DRIVEWAYR3-5R ONLY 18” x 24”MATCH SHEET 13NO SHEETS EAST OF HEREDRIVEWAYR3-5R ONLY 18” x 24” R3-5R ONLY 18” x 24”DRIVEWAYDRIVEWAYR3-5R ONLY 18” x 24” R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 15 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 ROAD WORK AHEAD W20-1NO SHEETS WEST OF HEREMATCH SHEET 16PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 28” REFL. CONE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES 350’350’350’ 295’ 590’ 295’DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAY 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD Pacific Coast Express 6835 S 212th St Kent, WA 98032 WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. RIGHT TWO LANES CLOSED AHEAD W20-501 W4-2L W4-2L NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 16 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 SPEED LIMIT 40 DRIVEWAYLEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES:MATCH SHEET 17MATCH SHEET 15ROAD WORK AHEAD W20-1 ROAD WORK AHEAD W20-1 METRO STOP UNAFFECTED NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED INTERURBAN TRAIL ACCESS MAINTAINED AT ALL TIMES. CONTRACTOR MAY CLOSE HALF THE CROSSWALK FOR CONSTRUCTION THEN FLIP WORK AREA TO OPPOSITE SIDE OF TRAIL TO COMPLETE WORKNO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE DRIVEWAYDRIVEWAYWORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours.72ND AVE S72ND AVE SNO TURN RESTRICTIONS NO TURN RESTRICTIONS 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE R3-5R MODIFIED OK 18” x 24” KEEP LEFT R4-7 18” x 24” NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS KEEP LEFT R4-7 18” x 24” DRIVEWAY NOTES (APPLIES TO ALL DRIVEWAYS WITHIN WORK AREA) DRIVEWAY ACCESS SHALL BE MAINTAINED AT ALL TIMES. WORK AREA SHALL BE RESTRICTED TO 1/2 OF TRAVELED ROW. WORK AREA WILL FLIP TO OPPOSITE SIDE OF ROW TO COMPLETE WORK. NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED METRO STOP UNAFFECTED R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 17 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: METRO STOP MAINTAINED METRO STOP UNAFFECTED 28” REFL. CONE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours.MATCH SHEET 16MATCH SHEET 18LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD ROAD WORK AHEAD W20-1 SPEED LIMIT 40 295’DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYNO TURN RESTRICTIONS NO TURN RESTRICTIONS KEEP LEFT R4-7 18” x 24” W4-2L NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR RTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD City of Kent SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 18 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. SPEED LIMIT 40 ROAD WORK AHEAD W20-1 LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD 295’ PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES MATCH SHEET 17NO SHEETS EAST OF HERE350’350’350’ ROAD WORK AHEAD W20-1 PCMS CITY OF KENT SHALL DETERMINE MESSAGE DRIVEWAYNO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE NO TURN RESTRICTIONS NO TURN RESTRICTIONS 48” x 24” G20-2 END ROAD WORK (OPTIONAL) KEEP LEFT R4-7 18” x 24” RIGHT TWO LANES CLOSED AHEAD W20-501W4-2L KEEP LEFT R4-7 18” x 24” 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES 295’DRIVEWAY 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR RWORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 19 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 ROAD WORK AHEAD W20-1 350’ 350’350’NO SHEETS WEST OF HEREMATCH SHEET 20ROAD WORK AHEAD W20-1 ROAD WORK AHEAD W20-1 DRIVEWAYDRIVEWAYNO TURN RESTRICTIONS DRIVEWAYNO TURN RESTRICTIONS NO TURN RESTRICTIONS RIGHT TWO LANES CLOSED AHEAD W20-501 W4-2L W4-2L NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED KEEP LEFT R4-7 18” x 24” 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 20 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419DRIVEWAYDRIVEWAYDRIVEWAYDRIVEWAYMATCH SHEET 19MATCH SHEET 2128” REFL. CONE. 295’ INTERURBAN TRAIL MAINTAINED AT ALL TIMES NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS KEEP LEFT R4-7 18” x 24” NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED DRIVEWAY NOTES (APPLIES TO ALL DRIVEWAYS WITHIN WORK AREA) DRIVEWAY ACCESS SHALL BE MAINTAINED AT ALL TIMES. WORK AREA SHALL BE RESTRICTED TO 1/2 OF TRAVELED ROW. WORK AREA WILL FLIP TO OPPOSITE SIDE OF ROW TO COMPLETE WORK. LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE SPEED LIMIT 40 NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 21 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOWDRIVEWAYNO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES:MATCH SHEET 20MATCH SHEET 22ROAD WORK AHEAD W20-1 ROAD WORK AHEAD W20-1 CROSSWALK CLOSED 36” x 24” R9-3XC CROSSWALK CLOSED 36” x 24” R9-3XCDRIVEWAYDRIVEWAY DRIVEWAYMETRO STOP RELOCATED METRO STOP UNAFFECTED 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE BE PREPARED TO STOP W20-7b W20-7a POLICE BOTH SIGNALS SHALL FLASH RED-ALL DIRECTIONS UPO SHALL COUNTERMAND SIGNALS (REQUIRES OFF-DUTY LAW ENFORCEMENT OFFICER) UPO’S SHALL CONTROL ALL TRAFFIC MOVEMENTS WITHIN BOTH INTERSECTIONS POLICE PROPERTY OWNER PERMISSION MUST BE OBTAINED TO BLOCK THESE DRIVEWAYS METRO STOP RELOCATED NO TURN RESTRICTIONS NO TURN RESTRICTIONS BE PREPARED TO STOP W20-7b W20-7a POLICE POLICE KEEP LEFT R4-7 18” x 24” WORK AREA WILL FLIP TO OPPOSITE SIDE OF INTERSECTION TO COMPLETE OVERLAY USING SAME SIGNS AND UPO’S WORK AREA WILL FLIP TO OPPOSITE SIDE OF INTERSECTION TO COMPLETE OVERLAY USING SAME SIGNS AND UPO’S R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE 28” REFL. CONE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 22 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: ROAD WORK AHEAD W20-1 NO SHEETS EAST OF HERE350’350’350’ LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD PCMS CITY OF KENT SHALL DETERMINE MESSAGE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES SPEED LIMIT 40 295’295’590’DRIVEWAYMATCH SHEET 21NO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE 48” x 24” G20-2 END ROAD WORK (OPTIONAL) RIGHT TWO LANES CLOSED AHEAD W20-501W4-2L W4-2L NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE S295’ SPEED LIMIT 40 SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 29 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 36” DELINEATOR POSTS & 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: W20-1 350’ 350’350’DRIVEWAYROAD WORK AHEAD RIGHT LANE CLOSED AHEAD W20-5R W4-2L W20-7a METRO STOP UNAFFECTED ROAD WORK AHEAD W20-1 W20-7a 350’350’350’ BE PREPARED TO STOP W20-7bW20-7a ROAD WORK AHEAD W20-1 CROSSWALK CLOSED 36” x 24” R9-3XC 24” x 36” R9-11 SIDEWALK CLOSED AHEAD R9-11 PLACED AT INTERURBAN TRAIL METRO STOP UNAFFECTED SIGNAL SHALL FLASH RED-ALL DIRECTIONS UPO SHALL COUNTERMAND SIGNALS (REQUIRES OFF-DUTY LAW ENFORCEMENT OFFICER) UPO’S SHALL CONTROL ALL TRAFFIC MOVEMENTS WITHIN INTERSECTION WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS THIS TCP MAY FLIP TO OPPOSITE SIDE OF S 212TH ST AND USED IN WB DIRECTION AT 77TH AVE S USING SAME SIGNS AND UPONO SHEETS WEST OF HERENO SHEETS EAST OF HERETRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE PCMS CITY OF KENT SHALL DETERMINE MESSAGE SIDEWALK CLOSED 36” x 24” R9-9 48” x 24” G20-2 END ROAD WORK (OPTIONAL) 48” x 24” G20-2 END ROAD WORK(OPTIONAL) 28” REFL. CONE LEFT TURN LANE CLOSED AHEAD R3-5L MODIFIED OK 18” x 24” 24” x 36” R9-11 SIDEWALK CLOSED AHEADR9-11 PLACED AT CROSSWALK LOCATED AT BLUE ORIGIN SOUTHERN DRIVEWAY CONE TOP SIGN (FACING NORTH) 36” DELINEATOR POST NO TURN RESTRICTIONS NO TURN RESTRICTIONS 28” REFL. CONE POLICE LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD SHALL MAINTAIN 11’ MIN. LANE WIDTH METRO STOP UNAFFECTED METRO STOP UNAFFECTED SIDEWALK CLOSED 36” x 24” R9-9 R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE PCMS CITY OF KENT SHALL DETERMINE MESSAGE SPEED LIMIT 40 28” REFL. CONE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 48” x 24” G20-2 END ROAD WORK (OPTIONAL) LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R RR RR RR RR RR RR RR RR RR RR RR RWORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours.NO SHEETS WEST OF HEREDRIVEWAYWASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 23 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 ROAD WORK AHEAD W20-1 350’350’350’ 295’ 295’ 590’DRIVEWAYDRIVEWAYMATCH SHEET 24METRO STOP UNAFFECTED W4-2L RIGHT TWO LANES CLOSED AHEAD W20-501 W4-2L NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 ROAD WORK AHEAD W20-1 NO ENCROACHMENT OF BNRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & BNRR SHALL DETERMINE MINIMUM BUFFER DISTANCE MATCH SHEET 11DRIVEWAYR3-5R ONLY 18” x 24” TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 24 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES:MATCH SHEET 23NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSEDDRIVEWAY MATCH SHEET 25ROAD WORK AHEAD W20-1 METRO STOP RELOCATED 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE KEEP LEFT R4-7 18” x 24” NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS KEEP LEFT R4-7 18” x 24” KEEP LEFT R4-7 18” x 24” NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 DRIVEWAYTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 25 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED MATCH SHEET 26METRO STOP RELOCATED DRIVEWAYDRIVEWAYNO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANEMATCH SHEET 24NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS DRIVEWAY NOTES (APPLIES TO ALL DRIVEWAYS WITHIN WORK AREA) DRIVEWAY ACCESS SHALL BE MAINTAINED AT ALL TIMES. WORK AREA SHALL BE RESTRICTED TO 1/2 OF TRAVELED ROW. WORK AREA WILL FLIP TO OPPOSITE SIDE OF ROW TO COMPLETE WORK. R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SSPEED LIMIT 40 28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANEDRIVEWAY TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 26 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSEDDRIVEWAY DRIVEWAYDRIVEWAYMATCH SHEET 27MATCH SHEET 25PROPERTY OWNER PERMISSION MUST BE OBTAINED TO BLOCK THIS DRIVEWAY (ALTERNATE DRIVEWAYS AVAILABLE) NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS PROPERTY OWNER PERMISSION MUST BE OBTAINED TO BLOCK THIS DRIVEWAY (ALTERNATE DRIVEWAYS AVAILABLE) KEEP LEFT R4-7 18” x 24” R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SDRIVEWAYTRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 27 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 350’ 295’MATCH SHEET 28590’ TANGENT CON’T FROM SHEET 28 MATCH SHEET 26METRO STOP UNAFFECTED ROAD WORK AHEAD W20-1 8350’ 350’ ROAD WORK AHEAD W20-1 350’DRIVEWAY28” REFL. CONE. OFFSET CONES TO MAINTAIN 11’ MIN WIDE TRAVEL LANE SPEED LIMIT 40 DRIVEWAYLEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD8 NO TURN RESTRICTIONS PROPERTY OWNER PERMISSION MUST BE OBTAINED TO BLOCK THIS DRIVEWAY (ALTERNATE DRIVEWAY AVAILABLE) PROPERTY OWNER PERMISSION MUST BE OBTAINED TO BLOCK THIS DRIVEWAY (ALTERNATE DRIVEWAY AVAILABLE) KEEP LEFT R4-7 18” x 24” TRAFFIC REVISION AHEAD W20-901 TRAFFIC REVISION AHEAD W20-901 R3-5R MODIFIED OK 18” x 24” R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE STRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: 28” REFL. CONE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 28 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD PCMS CITY OF KENT SHALL DETERMINE MESSAGE PLACEMENT OF ADVANCE WARNING SIGNS, CONE TAPERS/TANGENTS & PCMS SHOWN ON THIS SHEET DO NOT ACCURATELY REFLECT THE ACTUAL PLACEMENT LOCATION IN RELATIONSHIP TO REQUIRED SPACING DISTANCES SPEED LIMIT 40 48” x 24” G20-2 END ROAD WORK (OPTIONAL) ROAD WORK AHEAD W20-1 350’350’350’295’ TANGENT CON’T ON SHEET 27 590’DRIVEWAYMATCH SHEET 27NO SHEETS EAST OF HEREDRIVEWAYDRIVEWAYDRIVEWAYRIGHT TWO LANES CLOSED AHEAD W20-501 W4-2L W4-2L NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE S295’ SPEED LIMIT 40 SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 29 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: W20-1 350’ 350’350’DRIVEWAYROAD WORK AHEAD RIGHT LANE CLOSED AHEAD W20-5R W4-2L METRO STOP UNAFFECTED 350’ ROAD WORK AHEAD W20-1 24” x 36” R9-11 SIDEWALK CLOSED AHEAD R9-11 PLACED AT 84TH AVE S METRO STOP UNAFFECTED WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS THIS TCP MAY FLIP TO OPPOSITE SIDE OF S 212TH ST AND USED IN WB DIRECTION AT 77TH AVE S USING SAME SIGNS NO SHEETS WEST OF HERENO SHEETS EAST OF HERETRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE PCMS CITY OF KENT SHALL DETERMINE MESSAGE SIDEWALK CLOSED 36” x 24” R9-9 48” x 24” G20-2 END ROAD WORK(OPTIONAL) 48” x 24” G20-2 END ROAD WORK (OPTIONAL) 28” REFL. CONE SIDEWALK CLOSED 36” x 24” R9-9 CROSSWALK CLOSED 36” x 24” R9-3XC 24” x 36” R9-11 SIDEWALK CLOSED AHEAD R9-11 PLACED AT INTERURBAN TRAIL R3-5R MODIFIED OK 18” x 24” ROAD WORK AHEAD W20-1 W1-4 24” x 36” R9-11 SIDEWALK CLOSED AHEAD R9-11 PLACED AT CROSSWALK LOCATED AT BLUE ORIGIN SOUTHERN DRIVEWAY METRO STOP SHALL BE RELOCATED METRO STOP UNAFFECTED LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD 28” REFL. CONE NO TURN RESTRICTIONS NO TURN RESTRICTIONS SHALL MAINTAIN 11’ MIN. LANE WIDTH R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SWASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 31 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALEPCMS CITY OF KENT SHALL DETERMINE MESSAGE ROAD WORK AHEAD W20-1 295’ RIGHT LANE CLOSED AHEAD W20-5RW4-2L 350’350’350’ 48” x 24” G20-2 END ROAD WORK (OPTIONAL)SIDEWALK CLOSED 36” x 24” R9-9 SIDEWALK CLOSED 36” x 24” R9-9 R9-11 PLACED AT 76TH AVE S 24” x 36” R9-11 SIDEWALK CLOSED AHEAD NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS INTERURBAN TRAIL MAINTAINED AT ALL TIMES. 1/2 OF CROSSING SHALL BE LEFT OPEN DURING CONSTRUCTION THIS TCP MAY FLIP TO OPPOSITE SIDE OF S 212TH ST AND USED IN EB DIRECTION FOR INTERURBAN TRAIL WORK. WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. PCMS CITY OF KENT SHALL DETERMINE MESSAGE NO SHEETS EAST OF HERENO SHEETS WEST OF HERESPEED LIMIT 40 METRO STOP UNAFFECTED 28” REFL. CONE NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE R RR RR RR RR RR RR RR RR RR RR RR R72ND AVE S72ND AVE SWASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 31 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 1. ALL SIGNS AND SPACING SHALL CONFORM TO THE MUTCD. 2. NOTIFY LOCAL EMERGENCY SERVICES OF CLOSURE TIMES AND DATES (OPTIONAL). 3. ALERT KING COUNTY METRO CONSTRUCTION IN ADVANCE OF ROAD WORK (MANDATORY) 5 BUSINESS DAYS: 206-477-1140. 4. SIGN SPACING MAY BE REDUCED IN URBAN AREAS TO FIT ROAD CONDITIONS. 6. ALL SIGNS MIN. 48” x 48” UNLESS OTHERWISE SPECIFIED. 7. CHANNELIZATION DEVICES ARE 28” REFL. CONES (see TABLE 1) for spacing distances). 8. ALL SPACING MAY BE ADJUSTED TO ACCOMMODATE AT-GRADE INTERSECTIONS AND/OR DRIVEWAYS. GENERAL NOTES: TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALEPCMS CITY OF KENT SHALL DETERMINE MESSAGE ROAD WORK AHEAD W20-1 295’ RIGHT LANE CLOSED AHEAD W20-5RW4-2L 350’350’350’ 48” x 24” G20-2 END ROAD WORK (OPTIONAL)SIDEWALK CLOSED 36” x 24” R9-9 NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS NO TURN RESTRICTIONS INTERURBAN TRAIL MAINTAINED AT ALL TIMES. 1/2 OF CROSSING SHALL BE LEFT OPEN DURING CONSTRUCTION THIS TCP MAY FLIP TO OPPOSITE SIDE OF S 212TH ST AND USED IN EB DIRECTION FOR INTERURBAN TRAIL WORK. WORK NOTES: Single lane closure permitted M-F 9 AM-3 PM. Double lane closure permitted Su-Th 8 AM-6 AM. *see special provision 1-07.23 (1) for planning & paving working hours. PCMS CITY OF KENT SHALL DETERMINE MESSAGE NO SHEETS EAST OF HERENO SHEETS WEST OF HERESPEED LIMIT 40 METRO STOP UNAFFECTED 28” REFL. CONE NO ENCROACHMENT ON THIS TRAVELED LANE IS PERMITTED. IF ENCROACHMENT IS NECESSARY, LANE SHALL BE CLOSED LEGEND WORK AREA 28” REFL. CONE SIGN LOCATION EXISTING TRAFFIC FLOW TEMPORARY TRAFFIC FLOW SEQUENTIAL ARROWBOARD R9-11 PLACED AT 72ND AVE S 24” x 36” R9-11 SIDEWALK CLOSED AHEAD NO ENCROACHMENT OF UPRR TRACKS IS ALLOWED. CONSTRUCTION AND/OR DELINEATION IN CLOSE PROXIMITY TO RR TRACKS IS FORBIDDEN. CITY OF KENT & UPRR SHALL DETERMINE MINIMUM BUFFER DISTANCE TRAFFIC CONTROL PLAN KENT, WA NOT TO SCALE WASHINGTON STATE TRAFFIC CONTROL SUPERVISOR NAME: Christopher D Grose TCS CARD # 010124 EXP. DATE 1/31/2020 Christopher Grose ROAD WORK AHEAD SUPERVISOR PHONE NUMBER (office) 8/10/19 CONTRACTOR Kent, WA PROJECT LOCATION PHONE NUMBER (fax)SHEET NUMBER DATE PREPARED BY Chris Grose E-MAIL chris@traf ficcontrolplan.net 33 212TH OVERLAY JOB NAME Traffic of WA ControlPlan Co. PHONE# 253-258-1419 LEGEND WORK AREA SIGN LOCATION TEMPORARY TRAFFIC FLOW S 212 ST 77 AVE S76 AVE S72 AVE SS 196 ST 84 AVE SEND DETOUR M4-8a 24” x 18” (OPTIONAL) DETOUR (A)DETOUR (B) S 212 ST 72 AVE S84 AVE SS 196 ST M4-9 48” x 36” DETOUR END DETOUR M4-8a 24” x 18” (OPTIONAL) M4-9 48” x 36” DETOUR TO: EB 212TH PLAQUE TO: EB 212TH PLAQUE M4-9 48” x 36” DETOUR TO: EB 212THPLAQUE M4-9 48” x 36” DETOUR TO: WB 212THPLAQUE M4-9 48” x 36” DETOUR TO: WB 212THPLAQUE M4-9 48” x 36” DETOUR TO: WB 212TH PLAQUE M4-9 48” x 36” DETOUR TO: EB 212TH PLAQUE THIS SIGN ALSO SHOWN ON SHEET 5 M4-9 48” x 36” DETOUR TO: WB 212THPLAQUE THIS SIGN ALSO SHOWN ON SHEET 5 212th St. Preservation/Holcomb A - 4 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 PROJECT SIGN Your Tax Dollars at Work 212th Street Peservation 72nd Ave. S. to 84th Ave. S. $xxx,xxx KentWA.govContractor 212th St. Preservation/Holcomb A - 5 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 UPRR CONTRACTOR’S RIGHT OF ENTRY AGREEMENT The Contractor and sub-Contractors shall complete the Contractor’s Right of Entry Agreement and submit the Letter(s) to the City at the pre-construction meeting. The Contractor shall provide Certificate(s) of Insurance and endorsements as required in Section 1-07.18 (Insurance Requirements for Construction Projects of the Project Contract) and the insurance requirements in Contractor’s Right of Entry Agreement. Note that the more stringent requirement in either Section 1-07.18 or the Contractor’s Right of Entry Agreement is the controlling requirement for insurance in this contract. Please submit the certificate(s) and endorsements to the City at the pre-construction meeting. Only the General Contractor is required to provide Railroad Protective Liability.   All Sub-Contractors shall provide Certificate(s) of Insurance and endorsements as required in Section 1-07.18 and the insurance requirements in Contractor’s Right of Entry Agreement. Note that the more stringent requirement in either Section 1-07.18 or the Contractor’s Right of Entry Agreement is the controlling requirement for insurance in this contract. Please submit the certificate(s) and endorsements to the City at the pre-construction meeting. The City will submit all documents to the Union Pacific for processing and will pay Union Pacific administrative fees. UNION PACIFIC RAILROAD 1400 Douglas Street Omaha, Nebraska 68179 Mail Stop 1690 Daniel Peters Dcpeters02@up.com 402-544-8549 MAINTENANCE CONSENT LETTER 9/12/2019 Folder No.: 3154-81 DREW HOLCOMB CITY OF KENT 400 W GOWE ST KENT, WA 98115 Dear DREW HOLCOMB: RE: Work to consist of pavement rehabilitation, plane/pave, new HMA pavement, and simple maintenance of the at-grade road crossing DOT 396575R at Mile Post 169.02 on the Seattle Sub in Kent, King County, WA. It is CITY OF KENT’s intention to perform pavement rehabilitation, plane/pave, new HMA pavement, and conduct simple maintenance, to the at-grade road crossing DOT 396575R at Mile Post 169.02 on the Seattle Sub in Kent, King County, WA. This letter serves as an acceptance by the Railroad Company of the proposed work to be performed at the crossing. Attached hereto is a Railroad Location Print marked Exhibit A, which respectively illustrates the general location and the specifications of the proposed work at the public road crossing. If a contractor is to do any of the work performed on or about the Railroad Company’s trackage (including substantial maintenance and repair work), then the Public Entity shall require its contractor to execute the Railroad Company's form Contractor's Right of Entry Agreement. Public Entity acknowledges receipt of a copy of Contractor's Right of Entry Agreement and understanding its term, provisions and requirements, and will inform its contractor of the need to execute the Agreement. Under no circumstances will Public Entity's contractor be allowed on or about the Railroad Company’s trackage without first executing the Contractor's Right of Entry Agreement. In order to protect the property as well as for safety reasons, it is imperative that the Public Entity notify the Railroad Company’s Representative(s) at least 48-hours in advance prior to the installation of the subject crossing. The following information is furnished with regard to the local contact for the Railroad Company: Telecommunications ("Call Before You Dig"): 1-800-336-9193 Regards, Daniel Peters Public Projects - Real Estate Union Pacific Railroad Company 1400 Douglas Street STOP 1690 Omaha, NE 68179-1690 402-544-8549 Dcpeters02@up.com Peggy Ygbuhay 916-789-5033 EXHIBIT “A” RAILROAD LOCATION PRINT MAINTENANCE CONSENT/CONTRACTOR’S RIGHT OF ENTRY AGREEMENT UNION PACIFIC RAILROAD COMPANY Seattle Sub RAILROAD MILE POST 169.02 Kent, King COUNTY, WA To accompany an agreement with CITY OF KENT AND ITS CONTRACTOR Folder No. 3154-81 Date: 9/12/2019 WARNING IN ALL OCCASIONS, U.P. COMMUNICATIONS DEPARTMENT MUST BE CONTACTED IN ADVANCE OF ANY WORK TO DETERMINE EXISTENCE AND LOCATION OF FIBER OPTIC CABLE. PHONE: 1-(800) 336-9193 DOT No. 396575R M.P. 169.02 Seattle Sub UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 Articles of Agreement Page 1 of 4 Folder No.: 3154-81 UPRR Audit No.: CONTRACTOR'S RIGHT OF ENTRY AGREEMENT _____________________________________________ THIS AGREEMENT is made and entered into as of the _____ day of _________________, 20_____, by and between UNION PACIFIC RAILROAD COMPANY, a Delaware corporation ("Railroad"); and (Name of Contractor) a corporation (“Contractor”). RECITALS: Contractor has been hired by CITY OF KENT for pavement rehabilitation, plane/pave, new HMA pavement, simple maintenance of the at-grade public road crossing DOT 396575R at Mile Post 169.02 on the Seattle Sub in Kent, King County, WA, in the general location shown on the Railroad Location Print marked Exhibit A, attached hereto and hereby made a part hereof, which work is the subject of a Consent Letter dated 9/12/2019, between the Railroad and the CITY OF KENT. The Railroad is willing to permit the Contractor to perform the work described above at the location described above subject to the terms and conditions contained in this Agreement AGREEMENT: NOW, THEREFORE, it is mutually agreed by and between Railroad and Contractor, as follows: ARTICLE 1 - DEFINITION OF CONTRACTOR. For purposes of this agreement, all references in this agreement to Contractor shall include Contractor's contractors, subcontractors, officers, agents and employees, and others acting under its or their authority. For purposes of clarity, Contractor agrees that any CIC (defined below) hired by Contractor is a subcontractor of Contractor and therefore included in the defined term Contractor pursuant to the foregoing sentence. ARTICLE 2 - RIGHT GRANTED; PURPOSE. Railroad hereby grants to Contractor the right, during the term hereinafter stated and upon and subject to each and all of the terms, provisions and conditions herein contained, to enter upon and have ingress to and egress from the property described in the Recitals for the purpose of performing the work described in the Recitals above. The right herein granted to Contractor is limited to those portions of Railroad's property specifically described herein, or as designated by the Railroad Representative named in Article 4. UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 Articles of Agreement Page 2 of 4 ARTICLE 3 - TERMS AND CONDITIONS CONTAINED IN EXHIBITS B, C & D. The terms and conditions contained in Exhibit B and Exhibit C, attached hereto, are hereby made a part of this agreement. ARTICLE 4 - ALL EXPENSES TO BE BORNE BY CONTRACTOR; RAILROAD REPRESENTATIVE. A. Contractor shall bear any and all costs and expenses associated with any work performed by Contractor (including without limitation any CIC), or any costs or expenses incurred by Railroad relating to this agreement. B. Contractor shall coordinate all of its work with the following Railroad representative or his or her duly authorized representative (the "Railroad Representative"): James A. Johnson MGR I SIGNAL MNTCE 1055 Jackson St SE ALBANY, OR 97322 503/249-2237 C. Contractor, at its own expense, shall adequately police and supervise all work to be performed by Contractor and shall ensure that such work is performed in a safe manner as set forth in Section 7 of Exhibit B. The responsibility of Contractor for safe conduct and adequate policing and supervision of Contractor's work shall not be lessened or otherwise affected by Railroad's approval of plans and specifications involving the work, or by Railroad's collaboration in performance of any work, or by the presence at the work site of a Railroad Representative, or by compliance by Contractor with any requests or recommendations made by Railroad Representative. ARTICLE 5 - SCHEDULE OF WORK ON A MONTHLY BASIS. The Contractor, at its expense, shall provide on a monthly basis a detailed schedule of work to the Railroad Representative named in Article 4B above. The reports shall start at the execution of this Agreement and continue until this Agreement is terminated as provided in this Agreement or until the Contractor has completed all work on Railroad’s property. ARTICLE 6 - TERM; TERMINATION. A. The grant of right herein made to Contractor shall commence on the date of this Agreement, and continue until __________________________, unless sooner terminated as herein (Expiration Date) provided, or at such time as Contractor has completed its work on Railroad's property, whichever is earlier. Contractor agrees to notify the Railroad Representative in writing when it has completed its work on Railroad's property. B. This Agreement may be terminated by either party on ten (10) days written notice to the other party. ARTICLE 7 - CERTIFICATE OF INSURANCE. A. Before commencing any work and throughout the entire term of this Agreement, Contractor, at its expense, shall procure and maintain in full force and effect the types and minimum UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 Articles of Agreement Page 3 of 4 limits of insurance specified in Exhibit C of this agreement and require each of its subcontractors to include the insurance endorsements as required under Section 12 of Exhibit B of this agreement. B. Not more frequently than once every two (2) years, Railroad may reasonably modify the required insurance coverage to reflect then-current risk management practices in the railroad industry and underwriting practices in the insurance industry. C. Upon request of Railroad, Contractor shall provide to Railroad a certificate issued by its insurance carrier evidencing the insurance coverage required under Exhibit B. D. Contractor understands and accepts that the terms of this Article are wholly separate from and independent of the terms of any indemnity provisions contained in this Agreement. E. Upon request of Railroad, insurance correspondence, binders, policies, certificates and endorsements shall be sent to: Union Pacific Railroad Company 1400 Douglas St, Stop 1690 Omaha, NE 68179 Attn: Manager Folder No. 3154-81 ARTICLE 8 - PRECONSTRUCTION MEETING. If the work to be performed by the Contractor will involve the Railroad providing any flagging protection (or if a CIC is approved to provide flagging protection pursuant to the terms set forth herein) and/or there is separate work to be performed by the Railroad, the Contractor confirms that no work shall commence until the Railroad and Contractor participate in a preconstruction meeting involving flagging procedures and coordination of work activities of the Contractor and the Railroad (and any CIC, as applicable.) ARTICLE 9 - DISMISSAL OF CONTRACTOR'S EMPLOYEE. At the request of Railroad, Contractor shall remove from Railroad's property any employee of Contractor who fails to conform to the instructions of the Railroad Representative in connection with the work on Railroad's property, and any right of Contractor shall be suspended until such removal has occurred. Contractor shall indemnify Railroad against any claims arising from the removal of any such employee from Railroad's property. ARTICLE 10 - CROSSINGS; COMPLIANCE WITH MUTCD AND FRA GUIDELINES. No additional vehicular crossings (including temporary haul roads) or pedestrian crossings over Railroad's trackage shall be installed or used by Contractor without the prior written permission of Railroad. Any permanent or temporary changes, including temporary traffic control, to crossings must conform to the Manual of Uniform Traffic Control Devices (MUTCD) and any applicable Federal Railroad Administration rules, regulations and guidelines, and must be reviewed by the Railroad prior to any changes being implemented. In the event the Railroad is found to be out of compliance with federal UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 Articles of Agreement Page 4 of 4 safety regulations due to the Contractor’s modifications, negligence, or any other reason arising from the Contractor’s presence on the Railroad’s property, the Contractor agrees to assume liability for any civil penalties imposed upon the Railroad for such noncompliance. ARTICLE 11 - EXPLOSIVES. Explosives or other highly flammable substances shall not be stored or used on Railroad's property without the prior written approval of Railroad. IN WITNESS WHEREOF, the parties hereto have duly executed this agreement in duplicate as of the date first herein written. UNION PACIFIC RAILROAD COMPANY (Federal Tax ID #94-6001323) By:______________________________________ Daniel Peters Real Estate – Public Projects __________________________________________ (Name of Contractor) By_______________________________________ Printed Name:______________________________________ Title:_____________________________________________ UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit B General Terms & Conditions EXHIBIT B TO CONTRACTOR'S RIGHT OF ENTRY AGREEMENT GENERAL TERMS & CONDITIONS Section 1. NOTICE OF COMMENCEMENT OF WORK - RAILROAD FLAGGING - PRIVATE FLAGGING. A. Contractor agrees to notify the Railroad Representative at least ten (10) working days in advance of Contractor commencing its work and at least thirty (30) working days in advance of proposed performance of any work by Contractor in which any person or equipment will be within twenty-five (25) feet of any track, or will be near enough to any track that any equipment extension (such as, but not limited to, a crane boom) will reach to within twenty-five (25) feet of any track. B. No work of any kind shall be performed, and no person, equipment, machinery, tool(s), material(s), vehicle(s), or thing(s) shall be located, operated, placed, or stored within twenty-five (25) feet of any of Railroad's track(s) at any time, for any reason, unless and until a Railroad approved flagman is provided to watch for trains. Upon receipt of such thirty (30)-day notice, the Railroad Representative will determine and inform Contractor whether a flagman need be present and whether Contractor needs to implement any special protective or safety measures. C. Contractor shall be permitted to hire a private contractor to perform flagging or other special protective or safety measures (such private contractor being commonly known in the railroad industry as a contractor-in-charge (“CIC”)) in lieu of Railroad providing such services or in concert with Railroad providing such services, subject to prior written approval by Railroad, which approval shall be in Railroad’s sole and absolute discretion. If Railroad agrees to permit Contractor to utilize a CIC pursuant to the preceding sentence, Contractor shall obtain Railroad’s prior approval in writing for each of the following items, as determined in all respects in Railroad’s sole and absolute discretion: (i) the identity of the third-party performing the role of CIC; (ii) the scope of the services to be performed for the project by the approved CIC; and (iii) any other terms and conditions governing such services to be provided by the CIC. If flagging or other special protective or safety measures are performed by an approved CIC, Contractor shall be solely responsible for (and shall timely pay such CIC for) its services. Railroad reserves the right to rescind any approval pursuant to this Section 1, Subsection C., in whole or in part, at any time, as determined in Railroad’s sole and absolute discretion. D. If any flagging or other special protective or safety measures are performed by employees of Railroad and/or any contractor of Railroad, Railroad will bill Contractor for such expenses incurred by Railroad, unless Railroad and a federal, state or local governmental entity have agreed that Railroad is to bill such expenses to the federal, state or local governmental entity. If Railroad will be sending the bills to Contractor, Contractor shall pay such bills within thirty (30) days of Contractor's receipt of billing. E. If any flagging or other special protective or safety measures are performed by Railroad or a CIC, Contractor agrees that Contractor is not relieved of any of its responsibilities or liabilities set forth in this agreement. F. The provisions set forth in this subsection are only applicable for Flagging Services performed by employees of Railroad: the rate of pay per hour for each flagman will be the prevailing hourly rate in effect for an eight-hour day for the class of flagmen used during regularly assigned hours and overtime in accordance with labor agreements and schedules in effect at the time the work is performed. In addition to the cost of such labor, a composite charge for vacation, holiday, health and welfare, supplemental sickness, Railroad Retirement and unemployment compensation, supplemental pension, Employees Liability and Property Damage and Administration will be included, computed on actual payroll. The composite charge will be the prevailing composite charge in effect at the time the work is performed. One and one-half times the current hourly rate is paid for overtime, Saturdays and Sundays, and two and one-half times current hourly rate for holidays. Wage rates are subject to change, at any time, by law or by agreement between Railroad and its employees, and may be retroactive as a result of negotiations or a ruling of an authorized governmental agency. Additional charges on labor are also subject to change. If the wage rate or additional charges are changed, Contractor (or the governmental entity, as applicable) shall pay on the basis of the new rates and charges. If flagging is performed by Railroad, reimbursement to Railroad will be required covering the full eight-hour day during which any flagman is furnished, unless the flagman can be assigned to other Railroad work during a portion of such day, in which event reimbursement will not be required for the portion of the day during which the flagman is engaged in other Railroad work. Reimbursement will also be required for any day not actually UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit B General Terms & Conditions worked by the flagman following the flagman's assignment to work on the project for which Railroad is required to pay the flagman and which could not reasonably be avoided by Railroad by assignment of such flagman to other work, even though Contractor may not be working during such time. When it becomes necessary for Railroad to bulletin and assign an employee to a flagging position in compliance with union collective bargaining agreements, Contractor must provide Railroad a minimum of five (5) days notice prior to the cessation of the need for a flagman. If five (5) days notice of cessation is not given, Contractor will still be required to pay flagging charges for the five (5) day notice period required by union agreement to be given to the employee, even though flagging is not required for that period. An additional thirty (30) days notice must then be given to Railroad if flagging services are needed again after such five day cessation notice has been given to Railroad. Section 2. LIMITATION AND SUBORDINATION OF RIGHTS GRANTED A. The foregoing grant of right is subject and subordinate to the prior and continuing right and obligation of the Railroad to use and maintain its entire property including the right and power of Railroad to construct, maintain, repair, renew, use, operate, change, modify or relocate railroad tracks, roadways, signal, communication, fiber optics, or other wirelines, pipelines and other facilities upon, along or across any or all parts of its property, all or any of which may be freely done at any time or times by Railroad without liability to Contractor or to any other party for compensation or damages. B. The foregoing grant is also subject to all outstanding superior rights (whether recorded or unrecorded and including those in favor of licensees and lessees of Railroad's property, and others) and the right of Railroad to renew and extend the same, and is made without covenant of title or for quiet enjoyment. Section 3. NO INTERFERENCE WITH OPERATIONS OF RAILROAD AND ITS TENANTS. A. Contractor shall conduct its operations so as not to interfere with the continuous and uninterrupted use and operation of the railroad tracks and property of Railroad, including without limitation, the operations of Railroad's lessees, licensees or others, unless specifically authorized in advance by the Railroad Representative. Nothing shall be done or permitted to be done by Contractor at any time that would in any manner impair the safety of such operations. When not in use, Contractor's machinery and materials shall be kept at least fifty (50) feet from the centerline of Railroad's nearest track, and there shall be no vehicular crossings of Railroads tracks except at existing open public crossings. B. Operations of Railroad and work performed by Railroad personnel and delays in the work to be performed by Contractor caused by such railroad operations and work are expected by Contractor, and Contractor agrees that Railroad shall have no liability to Contractor, or any other person or entity for any such delays. The Contractor shall coordinate its activities with those of Railroad and third parties so as to avoid interference with railroad operations. The safe operation of Railroad train movements and other activities by Railroad takes precedence over any work to be performed by Contractor. Section 4. LIENS. Contractor shall pay in full all persons who perform labor or provide materials for the work to be performed by Contractor. Contractor shall not create, permit or suffer any mechanic's or materialmen's liens of any kind or nature to be created or enforced against any property of Railroad for any such work performed. Contractor shall indemnify and hold harmless Railroad from and against any and all liens, claims, demands, costs or expenses of whatsoever nature in any way connected with or growing out of such work done, labor performed, or materials furnished. If Contractor fails to promptly cause any lien to be released of record, Railroad may, at its election, discharge the lien or claim of lien at Contractor's expense. Section 5. PROTECTION OF FIBER OPTIC CABLE SYSTEMS. A. Fiber optic cable systems may be buried on Railroad's property. Protection of the fiber optic cable systems is of extreme importance since any break could disrupt service to users resulting in business interruption and loss of revenue and profits. Contractor shall telephone Railroad during normal business hours (7:00 a.m. to 9:00 p.m. Central Time, Monday through Friday, except holidays) at 1-800-336-9193 (also a 24-hour, 7-day number for emergency calls) to determine if fiber optic cable is buried anywhere on Railroad's property to be used by Contractor. If it is, Contractor will telephone the telecommunications company(ies) UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit B General Terms & Conditions involved, make arrangements for a cable locator and, if applicable, for relocation or other protection of the fiber optic cable. Contractor shall not commence any work until all such protection or relocation (if applicable) has been accomplished. B. IN ADDITION TO OTHER INDEMNITY PROVISIONS IN THIS AGREEMENT, CONTRACTOR SHALL INDEMNIFY, DEFEND AND HOLD RAILROAD HARMLESS FROM AND AGAINST ALL COSTS, LIABILITY AND EXPENSE WHATSOEVER (INCLUDING, WITHOUT LIMITATION, ATTORNEYS' FEES, COURT COSTS AND EXPENSES) ARISING OUT OF ANY ACT OR OMISSION OF CONTRACTOR, ITS AGENTS AND/OR EMPLOYEES, THAT CAUSES OR CONTRIBUTES TO (1) ANY DAMAGE TO OR DESTRUCTION OF ANY TELECOMMUNICATIONS SYSTEM ON RAILROAD'S PROPERTY, AND/OR (2) ANY INJURY TO OR DEATH OF ANY PERSON EMPLOYED BY OR ON BEHALF OF ANY TELECOMMUNICATIONS COMPANY, AND/OR ITS CONTRACTOR, AGENTS AND/OR EMPLOYEES, ON RAILROAD'S PROPERTY. CONTRACTOR SHALL NOT HAVE OR SEEK RECOURSE AGAINST RAILROAD FOR ANY CLAIM OR CAUSE OF ACTION FOR ALLEGED LOSS OF PROFITS OR REVENUE OR LOSS OF SERVICE OR OTHER CONSEQUENTIAL DAMAGE TO A TELECOMMUNICATION COMPANY USING RAILROAD'S PROPERTY OR A CUSTOMER OR USER OF SERVICES OF THE FIBER OPTIC CABLE ON RAILROAD'S PROPERTY. Section 6. PERMITS - COMPLIANCE WITH LAWS. In the prosecution of the work covered by this agreement, Contractor shall secure any and all necessary permits and shall comply with all applicable federal, state and local laws, regulations and enactments affecting the work including, without limitation, all applicable Federal Railroad Administration regulations. Section 7. SAFETY. A. Safety of personnel, property, rail operations and the public is of paramount importance in the prosecution of any work on Railroad property performed by Contractor. Contractor shall be responsible for initiating, maintaining and supervising all safety, operations and programs in connection with the work. Contractor shall, at a minimum, comply with Railroad's then current safety standards located at the below web address (“Railroad’s Safety Standards”) to ensure uniformity with the safety standards followed by Railroad's own forces. As a part of Contractor's safety responsibilities, Contractor shall notify Railroad if Contractor determines that any of Railroad's Safety Standards are contrary to good safety practices. Contractor shall furnish copies of Railroad’s Safety Standards to each of its employees before they enter Railroad property. http://www.up.com/cs/groups/public/@uprr/@suppliers/documents/up_pdf_nativedocs/pdf_up_supplier_safety_req.pdf B. Without limitation of the provisions of paragraph A above, Contractor shall keep the job site free from safety and health hazards and ensure that its employees are competent and adequately trained in all safety and health aspects of the job. C. Contractor shall have proper first aid supplies available on the job site so that prompt first aid services may be provided to any person injured on the job site. Contractor shall promptly notify Railroad of any U.S. Occupational Safety and Health Administration reportable injuries. Contractor shall have a nondelegable duty to control its employees while they are on the job site or any other property of Railroad, and to be certain they do not use, be under the influence of, or have in their possession any alcoholic beverage, drug or other substance that may inhibit the safe performance of any work. D. If and when requested by Railroad, Contractor shall deliver to Railroad a copy of Contractor's safety plan for conducting the work (the "Safety Plan"). Railroad shall have the right, but not the obligation, to require Contractor to correct any deficiencies in the Safety Plan. The terms of this agreement shall control if there are any inconsistencies between this agreement and the Safety Plan. Section 8. INDEMNITY. A. TO THE EXTENT NOT PROHIBITED BY APPLICABLE STATUTE, CONTRACTOR SHALL INDEMNIFY, DEFEND AND HOLD HARMLESS RAILROAD, ITS AFFILIATES, AND ITS AND THEIR OFFICERS, AGENTS AND EMPLOYEES (INDIVIDUALLY AN “INDEMNIFIED PARTY” OR COLLECTIVELY "INDEMNIFIED UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit B General Terms & Conditions PARTIES") FROM AND AGAINST ANY AND ALL LOSS, DAMAGE, INJURY, LIABILITY, CLAIM, DEMAND, COST OR EXPENSE (INCLUDING, WITHOUT LIMITATION, ATTORNEY'S, CONSULTANT'S AND EXPERT'S FEES, AND COURT COSTS), FINE OR PENALTY (COLLECTIVELY, "LOSS") INCURRED BY ANY PERSON (INCLUDING, WITHOUT LIMITATION, ANY INDEMNIFIED PARTY, CONTRACTOR, OR ANY EMPLOYEE OF CONTRACTOR OR OF ANY INDEMNIFIED PARTY) ARISING OUT OF OR IN ANY MANNER CONNECTED WITH (I) ANY WORK PERFORMED BY CONTRACTOR, OR (II) ANY ACT OR OMISSION OF CONTRACTOR, ITS OFFICERS, AGENTS OR EMPLOYEES, OR (III) ANY BREACH OF THIS AGREEMENT BY CONTRACTOR. B. THE RIGHT TO INDEMNITY UNDER THIS SECTION 8 SHALL ACCRUE UPON OCCURRENCE OF THE EVENT GIVING RISE TO THE LOSS, AND SHALL APPLY REGARDLESS OF ANY NEGLIGENCE OR STRICT LIABILITY OF ANY INDEMNIFIED PARTY, EXCEPT WHERE THE LOSS IS CAUSED BY THE SOLE ACTIVE NEGLIGENCE OF AN INDEMNIFIED PARTY AS ESTABLISHED BY THE FINAL JUDGMENT OF A COURT OF COMPETENT JURISDICTION. THE SOLE ACTIVE NEGLIGENCE OF ANY INDEMNIFIED PARTY SHALL NOT BAR THE RECOVERY OF ANY OTHER INDEMNIFIED PARTY. C. CONTRACTOR EXPRESSLY AND SPECIFICALLY ASSUMES POTENTIAL LIABILITY UNDER THIS SECTION 8 FOR CLAIMS OR ACTIONS BROUGHT BY CONTRACTOR'S OWN EMPLOYEES. CONTRACTOR WAIVES ANY IMMUNITY IT MAY HAVE UNDER WORKER'S COMPENSATION OR INDUSTRIAL INSURANCE ACTS TO INDEMNIFY THE INDEMNIFIED PARTIES UNDER THIS SECTION 8. CONTRACTOR ACKNOWLEDGES THAT THIS WAIVER WAS MUTUALLY NEGOTIATED BY THE PARTIES HERETO. D. NO COURT OR JURY FINDINGS IN ANY EMPLOYEE'S SUIT PURSUANT TO ANY WORKER'S COMPENSATION ACT OR THE FEDERAL EMPLOYERS' LIABILITY ACT AGAINST A PARTY TO THIS AGREEMENT MAY BE RELIED UPON OR USED BY CONTRACTOR IN ANY ATTEMPT TO ASSERT LIABILITY AGAINST ANY INDEMNIFIED PARTY. E. THE PROVISIONS OF THIS SECTION 8 SHALL SURVIVE THE COMPLETION OF ANY WORK PERFORMED BY CONTRACTOR OR THE TERMINATION OR EXPIRATION OF THIS AGREEMENT. IN NO EVENT SHALL THIS SECTION 8 OR ANY OTHER PROVISION OF THIS AGREEMENT BE DEEMED TO LIMIT ANY LIABILITY CONTRACTOR MAY HAVE TO ANY INDEMNIFIED PARTY BY STATUTE OR UNDER COMMON LAW. Section 9. RESTORATION OF PROPERTY. In the event Railroad authorizes Contractor to take down any fence of Railroad or in any manner move or disturb any of the other property of Railroad in connection with the work to be performed by Contractor, then in that event Contractor shall, as soon as possible and at Contractor's sole expense, restore such fence and other property to the same condition as the same were in before such fence was taken down or such other property was moved or disturbed. Contractor shall remove all of Contractor's tools, equipment, rubbish and other materials from Railroad's property promptly upon completion of the work, restoring Railroad's property to the same state and condition as when Contractor entered thereon. Section 10. WAIVER OF DEFAULT. Waiver by Railroad of any breach or default of any condition, covenant or agreement herein contained to be kept, observed and performed by Contractor shall in no way impair the right of Railroad to avail itself of any remedy for any subsequent breach or default. Section 11. MODIFICATION - ENTIRE AGREEMENT. No modification of this agreement shall be effective unless made in writing and signed by Contractor and Railroad. This agreement and the exhibits attached hereto and made a part hereof constitute the entire understanding between Contractor and Railroad and cancel and supersede any prior negotiations, understandings or agreements, whether written or oral, with respect to the work to be performed by Contractor. UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit B General Terms & Conditions Section 12. ASSIGNMENT - SUBCONTRACTING. Contractor shall not assign or subcontract this agreement, or any interest therein, without the written consent of the Railroad. Contractor shall be responsible for the acts and omissions of all subcontractors. Before Contractor commences any work, the Contractor shall, except to the extent prohibited by law; (1) require each of its subcontractors to include the Contractor as "Additional Insured” on the subcontractor's Commercial General Liability policy and Umbrella or Excess policies (if applicable) with respect to all liabilities arising out of the subcontractor's performance of work on behalf of the Contractor by endorsing these policies with ISO Additional Insured Endorsements CG 20 10, and CG 20 37 (or substitute forms providing equivalent coverage; (2) require each of its subcontractors to endorse their Commercial General Liability Policy with "Contractual Liability Railroads" ISO Form CG 24 17 10 01 (or a substitute form providing equivalent coverage) for the job site; and (3) require each of its subcontractors to endorse their Business Automobile Policy with "Coverage For Certain Operations In Connection With Railroads" ISO Form CA 20 70 10 01 (or a substitute form providing equivalent coverage) for the job site. UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit D General Terms & Conditions EXHIBIT C TO CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Union Pacific Railroad Company Insurance Requirements For Contractor’s Right of Entry Agreement During the entire term of this Agreement and course of the Project, and until all Project work on Railroad’s property has been completed and all equipment and materials have been removed from Railroad’s property and Railroad’s property has been clean and restored to Railroad’s satisfaction, Contractor shall, at its sole cost and expense, procure and maintain the following insurance coverage: A. Commercial General Liability insurance. Commercial general liability (CGL) with a limit of not less than $5,000,000 each occurrence and an aggregate limit of not less than $10,000,000. CGL insurance must be written on ISO occurrence form CG 00 01 12 04 (or a substitute form providing equivalent coverage). The policy must also contain the following endorsement, which must be stated on the certificate of insurance: • Contractual Liability Railroads ISO form CG 24 17 10 01 (or a substitute form providing equivalent coverage) showing “Union Pacific Railroad Company Property” as the Designated Job Site. • Designated Construction Project(s) General Aggregate Limit ISO Form CG 25 03 03 97 (or a substitute form providing equivalent coverage) showing the project on the form schedule. B. Business Automobile Coverage insurance. Business auto coverage written on ISO form CA 00 01 10 01 (or a substitute form providing equivalent liability coverage) with a combined single limit of not less $5,000,000 for each accident and coverage must include liability arising out of any auto (including owned, hired and non-owned autos). The policy must contain the following endorsements, which must be stated on the certificate of insurance: • Coverage For Certain Operations In Connection With Railroads ISO form CA 20 70 10 01 (or a substitute form providing equivalent coverage) showing “Union Pacific Property” as the Designated Job Site. • Motor Carrier Act Endorsement - Hazardous materials clean up (MCS-90) if required by law. C. Workers' Compensation and Employers' Liability insurance. Coverage must include but not be limited to: • Contractor's statutory liability under the workers' compensation laws of the state where the work is being performed. • Employers' Liability (Part B) with limits of at least $500,000 each accident, $500,000 disease policy limit $500,000 each employee. If Contractor is self-insured, evidence of state approval and excess workers compensation coverage must be provided. Coverage must include liability arising out of the U. S. Longshoremen's and Harbor Workers' Act, the Jones Act, and the Outer Continental Shelf Land Act, if applicable. D. Railroad Protective Liability insurance. Contractor must maintain "Railroad Protective Liability" (RPL) insurance written on ISO occurrence form CG 00 35 12 04 (or a substitute form providing equivalent coverage) on behalf of Railroad as named insured, with a limit of not less than $2,000,000 per occurrence and an aggregate of $6,000,000. The definition of "JOB LOCATION" and "WORK" on the declaration page of the policy shall refer to this agreement and shall describe all WORK or OPERATIONS performed under this agreement. Contractor shall provide this agreement to Contractor's insurance agent(s) and/or broker(s) and Contractor shall instruct such agent(s) and/or broker(s) to procure the insurance coverage required by this agreement. A BINDER STATING THE POLICY IS IN PLACE MUST BE SUBMITTED UNION PACIFIC RAILROAD COMPANY Contractor's Right of Entry (Private Flagging Contractor) Form Approved - UPRR Law Dept 08/01/2019 CONTRACTOR'S RIGHT OF ENTRY AGREEMENT Exhibit D General Terms & Conditions TO RAILROAD BEFORE THE WORK MAY COMMENCE AND UNTIL THE ORIGINAL POLICY IS FORWARDED TO UNION PACIFIC RAILROAD. E. Umbrella or Excess insurance. If Contractor utilizes umbrella or excess policies, these policies must “follow form” and afford no less coverage than the primary policy. F. Pollution Liability insurance. Pollution liability coverage must be included when the scope of the work as defined in the agreement includes installation, temporary storage, or disposal of any "hazardous" material that is injurious in or upon land, the atmosphere, or any watercourses; or may cause bodily injury at any time. If required, coverage may be provided in separate policy form or by endorsement to Contractors CGL or RPL. Any form coverage must be equivalent to that provided in ISO form CG 24 15 "Limited Pollution Liability Extension Endorsement" or CG 28 31 "Pollution Exclusion Amendment" with limits of at least $5,000,000 per occurrence and an aggregate limit of $10,000,000. If the scope of work as defined in this agreement includes the disposal of any hazardous or non- hazardous materials from the job site, Contractor must furnish to Railroad evidence of pollution legal liability insurance maintained by the disposal site operator for losses arising from the insured facility accepting the materials, with coverage in minimum amounts of $1,000,000 per loss, and an annual aggregate of $2,000,000. Other Requirements G. All policy(ies) required above (except business automobile, worker’s compensation and employers liability) must include Railroad as “Additional Insured” using ISO Additional Insured Endorsements CG 20 10, and CG 20 37 (or substitute forms providing equivalent coverage). The coverage provided to Railroad as additional insured shall not be limited by Contractor's liability under the indemnity provisions of this agreement. BOTH CONTRACTOR AND RAILROAD EXPECT THAT UNION PACIFIC RAILROAD COMPANY WILL BE PROVIDED WITH THE BROADEST POSSIBLE COVERAGE AVAILABLE BY OPERATION OF LAW UNDER ISO ADDITIONAL INSURED FORMS CG 20 10 AND CG 20 37. H. Punitive damages exclusion, if any, must be deleted (and the deletion indicated on the certificate of insurance), unless (a) insurance coverage may not lawfully be obtained for any punitive damages that may arise under this agreement, or (b) all punitive damages are prohibited by all states in which this agreement will be performed. I. Contractor waives all rights of recovery, and its insurers also waive all rights of subrogation of damages against Railroad and its agents, officers, directors and employees for damages covered by the workers compensation and employers liability or commercial umbrella or excess liability obtained by Contractor required in this agreement where prohibited by law. This waiver must be stated on the certificate of insurance. J. Prior to commencing the work, Contractor shall furnish Railroad with a certificate(s) of insurance, executed by a duly authorized representative of each insurer, showing compliance with the insurance requirements in this agreement. K. All insurance policies must be written by a reputable insurance company acceptable to Railroad or with a current Best's Insurance Guide Rating of A- and Class VII or better, and authorized to do business in the state where the work is being performed. L. The fact that insurance is obtained by Contractor or by Railroad on behalf of Contractor will not be deemed to release or diminish the liability of Contractor, including, without limitation, liability under the indemnity provisions of this agreement. Damages recoverable by Railroad from Contractor or any third party will not be limited by the amount of the required insurance coverage. 212th St. Preservation/Holcomb A - 6 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 BNSF ROADWAY SURFACING AGREEMENT The Contractor and sub-Contractors shall complete the BNSF Roadway Surfacing Agreement and submit the Letter(s) to the City at the pre-construction meeting. The Contractor shall provide Certificate(s) of Insurance and endorsements as required in Section 1-07.18 (Insurance Requirements for Construction Projects of the Project Contract) and the insurance requirements in Roadway Surfacing Agreement. Note that the more stringent requirement in either Section 1-07.18 or the Roadway Surfacing Agreement is the controlling requirement for insurance in this contract. Please submit the certificate(s) and endorsements to the City at the pre-construction meeting. Only the General Contractor is required to provide Railroad Protective Liability.   All Sub-Contractors shall provide Certificate(s) of Insurance and endorsements as required in Section 1-07.18 and the insurance requirements in Contractor’s Right of Entry Agreement. Note that the more stringent requirement in either Section 1-07.18 or the Roadway Surfacing Agreement is the controlling requirement for insurance in this contract. Please submit the certificate(s) and endorsements to the City at the pre-construction meeting. The City will submit all documents to the BNSF for processing and will pay BNSF administrative fees. (@)JL[ August20,2019 Jones Lang LaSalle Brokerage, Inc. 4200 Buckingham Rd., Suite 110 Fort Worth, Texas 76155 tel +1 817-230-2600, fax +1 817 306-8265 NOTE: This Agreement is contingent upon BNSF Roadmaster Approval City of Kent Attention: Mr. Drew Holcomb 400 W. Gowe St. Kent, WA 98032 Dear Mr. Holcomb: 19-63101 Attached please find a copy of the requested contract for execution by an official authorized to execute contract agreements on behalf of your company. Please print two (2) copies execute and return both copies with original signature for completion on part of BNSF Railway Company ("BNSF") to this office. Please note the agreements cannot be executed by BNSF without an approved insurance certificate. If there are any issues with your insurance, you will be contacted by a member of the Risk Management team of BNSF Railway. Please submit the following documents to BNSF @certfocus .com : 1. A Certificate of Insurance as required in the agreement. 2. A separate policy for Railroad Protective Liability Insurance as required in the agreement (ORIGINAL POLICY MUST BE PROVIDED). BNSF Railway Company will be the only insured party; OR; In lieu of providing a separate policy for Railroad Protective Liability Insurance, you may participate in the BNSF's Railroad Protective Policy by checking the appropriate box in the contract and including an additional $922.50 with your check and signed agreements. PLEASE ADVISE IF THIS PROJECT IS ARRA FUNDED. Acceptance and deposit of any check by BNSF does not constitute an agreement between BNSF and Licensee for the requested license. BNSF shall not be obligated to hold the check in a separate fund, but may commingle the funds with other funds of BNSF, and in no event shall BNSF be responsible for interest on said funds. The enclosed permit is not a binding agreement and shall become binding only when, and if, it is executed by you and fully approved and executed by BNSF Railway Company. Upon completion on behalf of BNSF, one fully executed counterpart will be returned for your records. The specifications/plans you provided may differ from BNSF's minimum specification requirements. Therefore, prior to your installation, please review the Exhibit A to determine the specifications necessary for your installation. Please be informed that if contracts, fees, and insurance are not returned within sixty (60) days, the processing fee will increase to $1 ,600.00. Sincerely, ~·~ Katie ~~? Permit Manager Attachment Law Department Approved Tracking #19-63101 ROADWAY SURFACING AGREEMENT This Roadway Surfacing Agreement ("Agreement") is entered into effective as of this the day of 2019, by and between CITY OF KENT, ("Contractor"), and BNSF RAILWAY COMPANY ("Railway"), a Delaware corporation. WHEREAS, Railway operates a freight transportation system by rail with operations throughout the United States and Canada; and WHEREAS, City of Kent desires Contractor to surface the roadway adjacent to and upon Railway's right of way, and Contractor is willing to perform such services. NOW, THEREFORE, in consideration for Railway entering this Agreement with Contractor and granting Contractor permission to enter upon the Premises (defined herein), Contractor agrees with Railway as follows: SECTION 1. SCOPE OF SERVICES Contractor shall perform the following services, hereinafter described as Work": Asphalt grind and overlay Line Segment 0051 and Mile Post 14.19 Performance of the Work will necessarily require Contractor to enter Railway's right of way and property ("Premises"). Contractor agrees that no work shall be commenced on the Premises until (i) this Agreement is executed by both Contractor and Railway; and (ii) Railway approves the insurance required to be maintained by Contractor hereunder. Contractor further agrees that if this Agreement is not executed by the owner, general partner, president, or vice-president of Contractor, Contractor shall furnish Railway with evidence certifying that the signatory is empowered to execute this Agreement. This License shall commence on the Effective Date and shall continue for a period one hundred eighty (180) days, subject to prior termination as hereinafter described. SECTION 2. PAYMENT OF FEES City of Kent shall be responsible for payment to Contractor for the Work performed under this Agreement. SECTION 3. RELEASE OF LIABILITY AND INDEMNITY Contractor hereby waives, releases, indemnifies, defends and holds harmless Railway for all judgments, awards, claims, demands, and expenses (including attorney's fees), for injury or death to all persons, including Railway's and Contractor's officers and employees, and for loss and damage to property belonging to any person, arising in any manner from Contractor's or any of Contractor's subcontractors' acts or omissions or any work performed on or about Railway's property or right-of-way. THE LIABILITY ASSUMED BY CONTRACTOR SHALL NOT BE AFFECTED BY THE FACT, IF IT IS A FACT, THAT THE DESTRUCTION, DAMAGE, DEATH, OR INJURY WAS OCCASIONED BY OR CONTRIBUTED TO BY THE NEGLIGENCE OF Form 433; Rev. 04/26/05 - 1 - Law Department Approved Tracking #19-63101 RAILWAY, ITS AGENTS, SERVANTS, EMPLOYEES OR OTHERWISE, EXCEPT TO THE EXTENT THAT SUCH CLAIMS ARE PROXIMATELY CAUSED BY THE INTENTIONAL MISCONDUCT OR GROSS NEGLIGENCE OF RAILWAY. THE INDEMNIFICATION OBLIGATION ASSUMED BY CONTRACTOR SHALL INCLUDE ANY CLAIMS, SUITS OR JUDGMENTS BROUGHT AGAINST RAILWAY UNDER THE FEDERAL EMPLOYEE'S LIABILITY ACT INCLUDING CLAIMS FOR STRICT LIABILITY UNDER THE SAFETY APPLIANCE ACT OR THE BOILER INSPECTION ACT, WHENEVER SO CLAIMED. Contractor further agrees, at its expense, in the name and on behalf of Railway, that it shall adjust and settle all claims made against Railway, and shall, at Railway's discretion, appear and defend any suits or actions of law or in equity brought against Railway on any claim or cause of action arising or growing out of or in any manner connected with any liability assumed by Contractor under this Agreement for which Railway is liable or is alleged to be liable. Railway shall give notice to Contractor, in writing, of the receipt or pendency of such claims and thereupon Contractor shall proceed to adjust and handle to a conclusion such claims, and in the event of a suit brought against Railway, Railway may forward summons and complaint or other process in connection therewith to Contractor, and Contractor, at Railway's discretion, shall defend, adjust, or settle such suits and protect, indemnify, and save harmless Railway from and against all damages, judgments, decrees, attorney's fees, costs, and expenses growing out of or resulting from or incident to any such claims or suits. It is mutually understood and agreed that the assumption of liabilities and indemnification provided for in this Agreement shall survive any termination of this Agreement. SECTION 4. INSURANCE. Contractor shall, at its sole cost and expense, procure and maintain during the life of this Agreement the following insurance coverage: A. Commercial General Liability Insurance. This insurance shall contain broad form contractual liability with a combined single limit of a minimum of $2,000,000 each occurrence and an aggregate limit of at least $ 4,000,000. Coverage must be purchased on a post 1998 ISO occurrence form or equivalent and include coverage for, but not limited to, the following: + Bodily Injury and Property Damage + Personal Injury and Advertising Injury + Fire legal liability • Products and completed operations This policy shall also contain the following endorsements, which shall be indicated on the certificate of insurance: • It is agreed that any workers' compensation exclusion does not apply to Railroad payments related to the Federal Employers Liability Act or a Railroad Wage Continuation Program or similar programs and any payments made are deemed not to be either payments made or obligations assumed under any Workers Compensation, disability benefits, or unemployment compensation law or similar law. Form 433; Rev. 04/26/05 -2- Law Department Approved Tracking #19-63101 • The definition of insured contract shall be amended to remove any exclusion or other limitation for any work being done within 50 feet of railroad property. • Any exclusions related to the explosion, collapse and underground hazards shall be removed. No other endorsements limiting coverage as respects obligations under this_Agreement may be included on the policy. B. Business Automobile Insurance. This insurance shall contain a combined single limit of at least $1,000,000 per occurrence, and include coverage for, but not limited to the following: + Bodily injury and property damage • Any and all vehicles owned, used or hired C. Workers Compensation and Employers Liability Insurance. This insurance shall include coverage for, but not limited to: • Contractor's statutory liability under the worker's compensation laws of the state(s) in which the work is to be performed. If optional under State law, the insurance must cover all employees anyway. • Employers' Liability (Part B) with limits of at least $500,000 each accident, $500,000 by disease policy limit, $500,000 by disease each employee. D. Railroad Protective Liability Insurance. This insurance shall name only the Railroad as the Insured with coverage of at least $2,000,000 per occurrence and $6,000,000 in the aggregate. The policy shall be issued on a standard ISO form CG 00 35 1 0 93 and include the following: • Endorsed to include the Pollution Exclusion Amendment (ISO form CG 28 31 10 93) • Endorsed to include the Limited Seepage and Pollution Endorsement • Endorsed to include Evacuation Expense Coverage Endorsement • No other endorsements restricting coverage may be added + The original policy must be provided to the Railroad prior to performing any work or services under this Agreement In lieu of providing a Railroad Protective Liability Policy, Licensee may participate in Licensor's Blanket Railroad Protective Liability Insurance Policy available to Licensee or its contractor. The limits of coverage are the same as above. The cost is $ 922.50. o I elect to participate in Licensor's Blanket Policy; o I elect not to participate in Licensor's Blanket Policy. E. Other Requirements: Where allowable by law, all policies (applying to coverage listed above) shall contain no exclusion for punitive damages and certificates of insurance shall reflect that no exclusion exists. Form 433; Rev. 04/26/05 -3- Law Department Approved Tracking #19-631 01 Contractor agrees to waive its right of recovery against Railroad for all claims and suits against Railroad. In addition, its insurers, through the terms of the policy or policy endorsement, waive their right of subrogation against Railroad for all claims and suits. The certificate of insurance must reflect the waiver of subrogation endorsement. Contractor further waives its right of recovery, and its insurers also waive their right of subrogation against Railroad for loss of its owned or leased property or property under contractor's care, custody or control. Contractor's insurance policies through policy endorsement, must include wording which states that the policy shall be primary and non-contributing with respect to any insurance carried by Railroad. The certificate of insurance must reflect that the above wording is included in evidenced policies. All policy(ies) required above (excluding Workers Compensation and if applicable, Railroad Protective) shall include a severability of interest endorsement and Railroad shall be named as an additional insured with respect to work performed under this agreement. Severability of interest and naming Railroad as additional insured shall be indicated on the certificate of insurance. Contractor is not allowed to self-insure without the prior written consent of Railroad. If granted by Railroad, any deductible, self-insured retention or other financial responsibility for claims shall be covered directly by contractor in lieu of insurance. Any and all Railroad liabilities that would otherwise, in accordance with the provisions of this Agreement, be covered by contractor's insurance will be covered as if contractor elected not to include a deductible, self-insured retention or other financial responsibility for claims. Prior to commencing the Work, contractor shall furnish to Railroad an acceptable certificate(s) of insurance including an original signature of the authorized representative evidencing the required coverage, endorsements, and amendments and referencing the contract audit/folder number if available. The policy(ies) shall contain a provision that obligates the insurance company(ies) issuing such policy(ies) to notify Railroad in writing at least 30 days prior to any cancellation, non-renewal, substitution or material alteration. This cancellation provision shall be indicated on the certificate of insurance. Upon request from Railroad, a certified duplicate original of any required policy shall be furnished. Any insurance policy shall be written by a reputable insurance company acceptable to Railroad or with a current Best's Guide Rating of A-and Class VII or better, and authorized to do business in the state(s) in which the service is to be provide. Contractor represents that this Agreement has been thoroughly reviewed by contractor's insurance agent(s)/broker(s), who have been instructed by contractor to procure the insurance coverage required by this Agreement. Allocated Loss Expense shall be in addition to all policy limits for coverages referenced above. Not more frequently than once every five years, Railroad may reasonably modify the required insurance coverage to reflect then-current risk management practices in the railroad industry and underwriting practices in the insurance industry. If any portion of the operation is to be subcontracted by contractor, contractor shall require that the subcontractor shall provide and maintain insurance coverages as set forth herein, naming Railroad as an additional insured, and shall require that the subcontractor shall Form 433; Rev. 04/26/05 -4- Law Department Approved Tracking #19-63101 release, defend and indemnify Railroad to the same extent and under the same terms and conditions as contractor is required to release, defend and indemnify Railroad herein. Failure to provide evidence as required by this section shall entitle, but not require, Railroad to terminate this Agreement immediately. Acceptance of a certificate that does not comply with this section shall not operate as a waiver of contractor's obligations hereunder. The fact that insurance (including, without limitation, self-insurance) is obtained by contractor shall not be deemed to release or diminish the liability of contractor including, without limitation, liability under the indemnity provisions of this Agreement. Damages recoverable by Railroad shall not be limited by the amount of the required insurance coverage. Prior to entering the Premises, Licensee shall and shall cause its contractor to comply with all Licensor's applicable safety rules and regulations. Prior to commencing any work on the Premises, Licensee shall complete and shall require its contractor to complete the safety- training program at the following Internet Website "http://www.contractororientation.com". This training must be completed no more than one year in advance of Licensee's entry on the Premises. For purposes of this section, Railroad shall mean "Burlington Northern Santa Fe Corporation", "BNSF Railway Company" and the subsidiaries, successors, assigns and affiliates of each. SECTION 5. PROTECTION OF RAILWAY FACILITIES AND RAILWAY FLAGGER SERVICES A The Contractor shall give a minimum of at least thirty (30) working days notice to the roadmaster at Marshaii.Fiores@BNSF.com, telephone (253) 591-2563, in advance of when flagging services will be required to bulletin the flaggers position and shall provide five (5) working days notice to the Road master to abolish the position per union requirements. B. Railway flagger and protective services and devices will be required and furnished when Contractor's work activities are located over or under of and within twenty-five (25) feet measured horizontally from center line of the nearest track and when cranes or similar equipment positioned outside of 25-foot horizontally from track center line that could foul the track in the event of tip over or other catastrophic occurrence, but not limited thereto for the following conditions: (1 ). When in the opinion of the Railway's representative, it is necessary to safeguard the Premises , employees, trains, engines and facilities. (2). When any excavation is performed below the bottom of tie elevation, if, in the opinion of Railway's representative, track or other Railway facilities may be subject to movement or settlement. (3). When work in any way interferes with the safe operation of trains at timetable speeds. (4). When any hazard is presented to Railway track, communications, signal, electrical, or other facilities either due to persons, material, equipment or blasting in the vicinity. Form 433; Rev. 04/26/05 -5- Law Department Approved Tracking #19-63101 (5). Special permission must be obtained from the Railway before moving heavy or cumbersome objects or equipment which might result in making the track impassable. C. Flagging services will be performed by qualified Railway flaggers. Licensee agrees to reimburse Licensor (pursuant to the terms of Section 5 (d) below) for all costs and expenses incurred by Licensor in connection with Licensee's use of the Premises or the presence, construction and maintenance of the Roadway, including but not limited to the furnishing of Licensor's flaggers and any vehicle rental costs incurred. Licensee shall bear the cost of flagger services and other safety measures provided by Licensor, when deemed necessary by Licensor's representative. Flagging costs shall include, but not be limited to, the following: pay for at least an eight (8) hour basic day with time and one-half or double time for overtime, rest days and holidays (as applicable); vacation allowance; paid holidays (as applicable); railway and unemployment insurance; public liability and property damage insurance; health and welfare benefits; transportation; meals; lodging and supervision. Negotiations for railway labor or collective bargaining agreements and rate changes authorized by appropriate Federal authorities may increase flagging rates. Flagging rates in effect at the time of performance by the flaggers will be used to calculate the flagging costs pursuant to this Section 5. D. All invoices are due thirty (30) days after the date of invoice. In the event that Licensee shall fail to pay any monies due to Licensor within thirty (30) days after the invoice date, then Licensee shall pay interest on such unpaid sum from the due date until paid at an annual rate equal to the lesser of (i) the prime rate last published in The Wall Street Journal in the"preceding December plus two and one-half percent (2-1/2%), or (ii) the maximum rate permitted by law. (1) A flagging crew generally consists of one employee. However, additional personnel may be required to protect the Premises and operations, if deemed necessary by the Railway's representative. (2) Each time a flagger is called, the minimum period for billing shall be the eight (8) hour basic day. (3) The cost of flagger services provided by the Railway, when deemed necessary by the Railway's representative, will be borne by the City's contractor. SECTION 6. INDEPENDENT CONTRACTOR In the performance of the Work under this Agreement, Contractor will be considered as an independent contractor, neither Contractor nor any of its employees, subcontractors, agents or servants will be considered as employees of Railway in any respect. Contractor shall have the exclusive right and duty to control the work of its employees. All persons employed by Contractor or any of its subcontractors in the performance of this Agreement shall be the sole employees of Contractor or its subcontractors. Contractor will be given general directions and instructions regarding the Work to be rendered under this Agreement; however, direct supervision of Contractor's employees will be Contractor's responsibility and obligation. Form 433; Rev. 04/26/05 -6- Law Department Approved Tracking #19-63101 IN WITNESS WHEREOF, the parties have caused this Agreement to be executed as of the day and year first written above. CITY OF KENT By: Print Name: Title: 400 W. Gowe St. Kent, WA 98032 ---------------------------- -7- BNSF RAILWAY COMPANY By: Jones Lang LaSalle Brokerage, Inc., its Attorney in Fact 4200 Buckingham Rd., Suite 110 Fort Worth, TX 76155 Shane Krueger Title: Vice President -Permits & S pecial Proj . Form 433; Rev. 04/26/05 COORDINATE SYSTEM : .ml[ EXHIBIT "A" ATTACHEDTOCONTRACT8EnNEEN BNSF RAILWAY COMPANY AND CITY OF KENT TRACKING NO . ..1i:§ll!U I ~MU~ ---------~--------------------- I SCALE:1 IN= 50FT NORTHweST DIV. SECTION: 1Z. 1-r-u < ·...,. <t u: w a: 0.. SEATTLE SUBDIV. L.S . 0051 : DATE: 7/1/2019 LEGEND: 1Z21 PREMISES c:J RIGHTOFWAYLINE -TRACK KENT COUNTY OF KING S 212th St DESCRIPTION: TOWNSHIP & RANGE: ~ MERIDIAN: !M!.LM. i r • Ill 2 PARCELS OF LAND CONTAINING A TOTAL OF 4,977 SQ FT. (0.11 A.C.) MORE OR LESS SHOWN HATCHED. TO BE USED FOR ROADWAY RESURFACING. STATEOF WA ~ g (II ; h1 ~ .rMrJ Jj){iR(tl~.ll.~. peoE!e: Earthstar G~raf11 ics, Cf\!ES/Airbu s OS :::U~O!\r.l_l ~S_:.A~.G~ID..:J:G~ar}~ ~~IS ~:!~o R!~i~ ~ DRAWN BY:JNC DRAWING NO . 75964 212th St. Preservation/Holcomb A - 7 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 SPECIFICATION - RETROREFLECTIVE AND SKID RESISTANT BIKE LANE GREEN PREFORMED THERMOPLASTIC PAVEMENT MARKINGS PM VG LTGR w SA 01.01.18 SPECIFICATION RETROREFLECTIVE AND SKID RESISTANT BIKE LANE GREEN PREFORMED THERMOPLASTIC PAVEMENT MARKINGS 1. USE: A durable, high skid resistant, retroreflective pavement marking material suitable for use as bike lane, bike path, roadway, intersection, airport, commercial or private pavement delineation and markings. 1.1. The markings must be a resilient light green color thermoplastic product, the surface of which must contain glass beads and abrasives in an alternating pattern optimizing both skid resistance and retroreflectivity. 1.2. The markings must be resistant to the detrimental effects of motor fuels, lubricants, hydraulic fluids etc. 1.3. The material shall be capable of being affixed to bituminous and/or Portland cement concrete pavements by the use of the normal heat of a propane torch or infrared heater. 1.4. The markings must be capable of conforming to pavement contours, breaks and faults through the action of traffic at normal pavement temperatures. The markings shall have resealing characteristics, such that it is capable of fusing with itself and previously applied thermoplastic when heated with the torch. 1.5. The markings shall not have minimum ambient and road temperature requirements for application, storage, or handling. When manufacturer’s standard application procedures require the use of a 2-component sealer, the material shall be capable of being applied with a compatible 2-component sealer recommended by the manufacturer, at minimum ambient and surface temperatures of 45⁰F without any special storage, preheating or treatment of the material before application. 1.6. If required, white, retroreflective and skid resistant preformed thermoplastic symbols and/or word legends may be incorporated into the light green retroreflective and skid resistant material background in an interconnected fashion, such that the two materials shall be factory assembled together and applied as a single layer. 2. MANUFACTURING LOCATION, CONTROL AND ISO CERTIFICATION: The marking material must be produced in the United States, and the manufacturer must be ISO 9001:2015 certified for design, development and manufacturing of preformed thermoplastic pavement markings, and provide proof of current certification. 3. MATERIAL: Must be composed of an ester modified rosin resistant to degradation by motor fuels, lubricants etc. in conjunction with aggregates, pigments, binders, abrasives, and glass beads which have been factory produced as a finished product, and meets the requirements of the current edition of the Manual on Uniform Traffic Control Devices for Streets and Highways. The thermoplastic material conforms to AASHTO designation M249, with the exception of the relevant differences due to the material being supplied in a preformed state and being supplied in a color other than white or yellow. 3.1. Graded Glass Beads: 3.1.1. The material must contain a minimum of thirty percent (30%) intermixed graded glass beads by weight. The intermixed beads shall conform to AASHTO designation M247, with minimum 80% true spheres and minimum refractive index of 1.50. 3.1.2. The material must have factory applied coated surface beads and abrasives in addition to the intermixed beads at a rate of 1/2 lb. (.23 kg) [± 20%] per 11 sq. ft. (1 sq. m). The surface beads and abrasives must be applied in an alternating arrangement across the surface of the material so that the surface is covered in what is best described as a “checkerboard” pattern of glass beads and abrasive materials. The abrasive material must have a minimum hardness of 9 (Mohs scale). The factory applied coated surface beads shall have a minimum of 80% true spheres, minimum refractive index of 1.50, and meet the following gradation: Size Gradation Retained, % Passing, % US Mesh Um 12 1700 0 - 2% 98 - 100% 14 1400 0 - 6% 94 - 100% 16 1180 1 - 21% 79 – 99% 18 1000 28 - 62% 38 - 72% 20 850 62 - 71% 29 – 38% 30 600 67 - 77% 23 - 33% 50 300 86 - 95% 5 – 14% 80 200 97-100% 0 - 3% PM VG LTGR w SA 01.01.18 3.2. Pigments: Light Green: The material shall be manufactured with appropriate pigment to ensure that the resulting colors complies with the Light Green color as specified in the FHWA Memorandum dated April 15th, 2011: Interim Approval for Optional Use of Green Colored Pavement for Bike Lanes (IA-14). 3.2.1. Daytime chromaticity coordinates for the color used for green colored pavement shall be as follows: 1 2 3 4 X y x y x y x y 0.230 0.754 0.266 0.500 0.367 0.500 0.444 0.555 3.2.2. Nighttime chromaticity coordinates for the color used for green colored pavement shall be as follows: 1 2 3 4 X y x y x y x y 0.230 0.754 0.336 0.540 0.450 0.500 0.479 0.520 3.2.3. The pigment system must not contain heavy metals or any carcinogen, as defined in 29 CFR 1910.1200 in amounts exceeding permissible limits as specified in relevant Federal Regulations. 3.3. Heating indicators: The top surface of the material (same side as the factory applied surface beads/abrasives) shall have regularly spaced indents. The closing of these indents during application, shall act as a visual cue that the material has reached a molten state allowing for satisfactory adhesion and proper bead and abrasives embedment, and as a post - application visual cue that the application procedures have been followed. 3.4. Skid Resistance: The surface of the preformed thermoplastic material shall contain factory applied non-skid material with a minimum hardness of 9 (Mohs scale). Upon application the material shall provide a minimum skid resistance value of 60 BPN when tested according to ASTM E 303. 3.5. Thickness: The material must be supplied at a minimum thickness of 90 mils (2.29 mm) or 125 mils (3.15 mm). 3.6. Retroreflectivity: The material, when applied in accordance with manufacturer’s guidelines, must demonstrate a uniform level of sufficient nighttime retroreflection when tested in accordance to ASTM E 1710. The applied material must have an initial minimum intensity reading of 50 mcd·m-2·lx-1, as measured with a Delta pavement marking retroreflectometer. Note: Initial retroreflection and skid resistance are affected by the amount of heat applied during installation. When ambient temperatures are such that greater amounts of heat are required for proper installation, initial retroreflection and skid resistance levels may be affected. 3.7. Environmental Resistance: The material must be resistant to deterioration due to exposure to sunlight, water, salt or adverse weather conditions and impervious to oil and gasoline. 3.8. Abrasives: The abrasives and surface beads must be applied in an alternating arrangement across the surface of the material so that the surface is covered in what is best described as a “checkerboard” pattern of glass beads and abrasive materials. The abrasive material must have a minimum hardness of 9 (Mohs scale). 4. APPLICATION: 4.1. Asphalt: The materials shall be applied using the propane torch or infrared heater method recommended by the manufacturer, without minimum requirements for ambient and road temperatures and without any preheating of the pavement to a specific temperature. The material must be able to be applied without the use of a thermometer. The pavement shall be clean, dry and free of debris. Supplier must enclose application instructions in English and Spanish with each box/package only pertaining to an application method that does not require preheating of the pavement to a specific temperature before application. When manufacturer’s standard application procedures require the use of 2 -component sealer for large volumes of material, the compatible 2-component sealer supplied by the material manufacturer shall be applied to the substrate prior to material application, to ensure proper adhesion and provide bond reinforcement. 4.2. Portland Concrete: The same application procedure shall be used as described under Section 4.1. However, a compatible primer sealer shall be applied before application to assure proper adhesion. 5. PACKAGING: The preformed thermoplastic markings shall be placed in protective plastic film with cardboard stiffeners where necessary to prevent damage in transit. Linear material must be cut to a maximum of 3 ft. (.91 m) long pieces. Legends and symbols must also be supplied in flat pieces. The cartons in which packed shall be non-returnable, shall contain a minimum of 35% post- consumer recycled materials, shall not exceed 40 in. (1.02m) in length and 25 in. (.64 m) width, and shall be labeled for ease of identification. The weight of the individual carton must not exceed 70 lb. (32 kg). A protective film around the box must be applied in order to protect the material from rain or premature aging. When required, the 2-component sealer must be supplied by the material manufacturer in 300/600ml cartridges, along with 2-component sealer application supplies. 6. TECHNICAL SERVICES: The successful bidder shall provide technical services as required. Regionally-located manufacturer’s representative, employed directly by the manufacturer, can provide no-cost on-site training for proper application. 7. PERFORMANCE: The preformed thermoplastic markings shall meet state specifications and be approved for use by the appropriate state agency. 212th St. Preservation/Holcomb A - 8 March 8, 2021 Federal Aid Number: STPUL-1250(009) Project Number: 19-3003 STATE AND FEDERAL PREVAILING WAGE RATES 312212021 about:blank State of Washington Department of Labor & lndustries Prevaiting Wage Section - Telephone 360'902-5335 PO Box 44540, OlYmPia, WA 98504-4540 Washington State Prevailing Wage The pREVAILING WAGES tisted here inctude both the hourty wage rate and the hourty rate of fringe benefits. On pubtic works projects, worker's wage and benefit rates must add to not less than this totat. A brief description of overtime catcutation requirements are provided on the Benefit Code Key. Journey Level Prevailing Wage Rates for the Effective Date: 312212021 Job Classification *Risk Class View View View View View View View View View View View View View View View View View County King King King King King King King King King King King King King King King King King Trade Asbestos Abatement Workers Boitermakers Brick Mason Brick Mason Buitding Service Emplgyees Buitding Service Emp&ySeE Bui ldi ng Service Emplgyees Buitdi ng Service Emp&ycCS Cabinet Makers (ln ShoP) Carpsnlgerg Carpenlgg Caroenters Carpsnlsfs Carpenlers Carpenlers Carpenlggg Cement Masons King Cement Masons Kins Cement Masons King Cement Masons Journey Level Journey Level Journey Level Pointer- Cau Iker-Cleaner Janitor Traveting Waxer/ShamPooer Window Cteaner (Non-Scaffotd) Window Cteaner (Scaffotd) Journey Levet AcousticaI Worker Carpenter Carpenters on Stationary Tools Creosoted Material Ftoor Finisher Floor Layer Scaffotd Erector Apptication of atl ComPosition Mastic Apptication of atl Epoxy MateriaI Application of atl Ptastic Materiat Application of Sealing Compound Application of Underlayment Buitding GeneraI Composition or Katman Floors Concrete Paving Curb & Gutter Machine Curb & Gutter, Sidewatks Curing Concrete W"ge Holiday Overtime Note ss2.39 5p 1H 570.79 sN 1C s60.57 7E 1N 560.57 7E 1N 526.28 55 2F s26.63 55 2F s29.98 55 2F s30.98 ss 2F 522.74 L s64.94 7A 4C 564.94 7A 4C s6s.07 7A 4C 565.07 7A 4C 564.94 7A 4C 564.94 7A 4C s64.94 7A 4C 564.84 7A 4U 564.34 7A 4U s64.84 7A 4U 564.34 7A 4U 564.84 7A 564.34 7A 564.84 7A 564.34 7A 564.84 7A 564.34 7A 564.34 7A King King King King King King King about:blank Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons 4U 4U 4U N 4U 4U 4U View View View View View View View View View View 'U18 3t22t2021 King King King King King King Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Cement Masons Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Divers & Tenders Dredge Workers Dredge Workers Dredge Workers Dredge Workers Dredge Workers Dredge Workers Dredse Workers UrreILAppjsator Drnryall-Tapsrs EtectricaI Fixture Maintenance Workers Etectricians - lnside Etectricians - lnside Etectricians - lnside about:blank Finish Cotored Concrete Floor Grinding Ftoor Grinding/ Polisher Green Concrete Saw, setf' powered Grouting of atl Ptates Grouting of al,t Titt-up Panets Gunite Nozzteman Hand Powered Grinder Journey Level Patching Concrete Pneumatic Power Toots Power Chipping & Brushing Sand Btasting Architectural Finish Screed & Rodding Machine Spackting or Skim Coat Concrete Troweting Machine Operator Troweling Machine Operator on Colored Slabs Tunnel Workers Bett/Vehicte or Submersible Operator (Not Under Pressure) Dive Supervisor/Master Diver Diver On Standby Diver Tender Manifotd Operator Manifotd Operator Mixed Gas Remote Operated Vehicte Operator/Technician Remote Operated Vehicte Tender Assistant Engineer Assistant Mate (Deckhand ) Boatmen Engineer Wetder Leverman, Hydraulic Mates Oiter Journey Levet Journey Level Journey Level Cabte Spticer Cabte Spticer (tunnet) Certified Welder 564.84 7A 564.84 7A 564.34 7A 564.84 7A 564.34 7A 564.34 7A 564.84 7A s64.84 7A 564.34 7A 564.34 7A s64.84 7A 50+.sq 7A s64.84 7A 564.84 7A s64.34 7A 564.84 7A 564.84 7A 564.84 7A sl18.80 7A 581.98 7A 5118.80 7A 576.98 7A 569.91 7A 569.e1 7A s74.91 7A s69.91 7A 565.19 7A s70.62 5p 570.07 5p 570.62 5p 571.97 sp 573.41 sp 570.62 5p 570.07 5p 50q.sq 5p s65.31 5P s31.99 sL 5qz View 8V View View View View View View 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4U 4C 4C 4C 4C 4C 4C 4C 4C 4C 3F 3F 3F 3F 3F 3F 3F 1H 1E 1E 4E 4E 4E View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View King King King King King King King King King King King King King ng ng ng ng ng ng ng Ki Ki Ki Ki Ki Ki Ki King King King King King King King King King King King King King King 7C 7C 7C 57 46 44 5sq S8e about:blank 2t18 312212021 King King King King King King King King King King King King King King King King King King about:blank Electricians - lnside Certified Wetder (tunnet) Etectricians - lnside Construction Stock Person Etectricians - lnside Journey Level Etectricians - lnside Journey Level (tunnet) Etectricians - Motor Shop- Journey Level Etectricians - Powerline Cabte Spticer Construction Etectricians - Powerline Certified Line Wetder Construction Etectricians - Powertine Groundperson Construction Etectricians - Powerline Heavy Line Equipment Construction OPerator Etectricians - Powertine Journey Levet Lineperson Construction Etectricians - Powertine Line Equipment Operator Construction Etectricians - Powertine Meter lnstatler Construction Etectricians - Powertine Pote Sprayer Construction Electricians - Powertine Powderperson Construction Etectronic Technicians Journey Level Elevator Constructors Mechanic Etevator Constructors Mechanic ln Charge Fabricated Precast Concrete Att Ctassifications - ln-Factory Products Work OntY Fence Erectors Fence Erector Fence Erectors Fence Laborer Ftaggers JourneY Level Gtaziers JourneY Level Heat & Frost lnsulators And Journeyman Asbestos Workers Heating lquipi1ent Megha11gg Journey Level Hod Carriers & Mason Tenders Journey Levet lndustrial Power Vacuum Journey Level Cleaner lntand Boatmen Boat Operator lntand Boatmen Cook lntand Boatmen Deckhand lntand Boatmen Deckhand Engineer lntand Boatmen Launch OPerator lnland Boatmen Mate I nspsgflsn rcleaning/ Sea ti n g Of Cleaner Operator, Foamer Sewer & Water SylleIIlS ry OPerator Remote Control I nspss$sn/ Cteaning / Seating Of Grout Truck Operator Sewer & Water Sy$ems BY Remote Control s96.02 7C s44.78 7C 586.30 7C s92.57 7C 547.53 sA s82.39 5A s75.64 sA 549.17 5A 575.64 5A 575.64 sA 564.54 sA 549.17 575.64 556.4e 553.s7 7E s100.51 7p 5108.53 7p s18.25 58 544.40 7A 544.40 7A 544.40 7A s69.26 7L 579.43 5J 589.61 7F s54.01 7A 513.69 561.41 58 s56.48 58 s57.48 58 558.81 58 5s8.89 58 ss7.31 sB 531.49 View View View View View View View View View View View 8W View View View View View View View 8Y View 8Y View 8Y View View View View 8Y View View View View View View View View View 5A 5A 5A 4E 4E 4E 4E 1B 4D 4D 4D 4D 4D 4D 4D 4D 4D 1E 4A 4A 1R 4V 4V 4V 1Y 4H 1E 4V ! 1K 1K 1K 1K 1K 1K 1 King King King King King King King King King King King King King King King King 7 about:blank s13.6e View 3118 3122t2021 King King King King King King King King King King King King King King King King King King King King King King King King King King King King King King King lnspectionllleaning/Seating Of Head Operator Sewer & Water SyllenE-ts)t Remote ControI lnspection/Cteaning/Seating Of Technician Sewer & Water Sy5lgnltsy Remote ControI lnspec$on/Cteening/Seating Of Tv Truck Operator Sewer & Water Systemf-E)t Remote Control I nsutation Appticalors lronworkers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers about:blank Journey Level Journeyman Air, Gas Or Etectric Vibrating Screed Airtrac Dritl Operator Batlast Regutar Machine Batch Weighman Brick Pavers Brush Cutter Brush Hog Feeder Burner Caisson Worker Carpenter Tender Cement Dumper-paving Cement Finisher Tender Change House Or Dry Shack Chipping Gun (30 Lbs. And Over) Chipping Gun (Under 30 Lbs.) Choker Setter Chuck Tender Ctary Power Spreader Ctean-up Laborer Concrete Dumper/Chute Operator Concrete Form Stripper Concrete Ptacement Crew Concrete Saw Operator/Core Dritter Crusher Feeder Curing Laborer Demotition: Wrecking & Moving (lnct. Charred Materiat) Ditch Digger Diver Dritt Operator (Hydrautic, Diamond) Dry Stack Watts Dump Person Epoxy Technician 524.91 51e.33 520.45 564.94 7A s76.78 7N 552.39 7A s54.01 7A s52.39 7A 544.40 7A ss2.39 7A s52.39 7A ss2.39 7A 552.39 7A 554.01 7A 5s2.39 7A 553.35 7A 552.39 7A 552.39 7A ss3.3s 7A s52.39 7A 552.39 7A 552.39 7A ss3.35 7A s52.39 7A 553.35 7A s52.39 7A s53.35 7A s53.3s 7A s44.40 7A 552.39 7A 552.39 7A 552.3e 7A 554.01 7A s53.35 7A 552.39 7A 5s2.39 7A s52.39 7A 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View View View View View View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 1 ! 1 4C 10 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4Y 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V King King King King King King about:blank 4118 3t22t2021 about:blank Erosion Control Worker Fatter & Bucker Chain Saw Fine Graders Firewatch Form Setter Gabian Basket Buitders GeneraI Laborer Grade Checker & Transit Person Grinders Grout Machine Tender Groutmen (Pressure) lnctuding Post Tension Beams GuardraiI Erector Hazardous Waste Worker (Levet A) Hazardous Waste Worker (Levet B) Hazardous Waste Worker (Levet C) High Scaler Jackhammer Laserbeam Operator Maintenance Person Manhote Bui lder-Mudman Material Yard Person Motorman- Dinky Locomotive Nozzteman (Concrete Pump, Green Cutter When Using Combination Of High Pressure Air & Water On Concrete & Rock, Sandbtast, Gunite, Shotcrete, Water Blaster, Vacuum Btaster) Pavement Breaker Pitot Car Pipe Layer Lead Pipe Layer/Taitor Pipe Pot Tender Pipe Reliner Pipe Wrapper Pot Tender Powderman Powderman's Hetper Power Jacks Railroad Spike Putter - Power Raker - Asphatt Re-timberman Remote Equipment Operator King King King King King King King King King King King King King King King King King King King King King King King Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers ss2.39 7A s53.35 7A 552.39 7A 544.40 7A 5s2.39 7A ss2.3e 7A s52.39 7A 5s4.01 7A 552.39 7A 5s2.39 7A ss3.35 7A s52.39 7A ss4.01 7A ss3.3s 7A ss2.39 7A ss+.or 7A s53.3s 7A 553.3s 7A s52.39 7A 553.35 7A ss2.39 7A 5s3.3s 7A ss3.3s 7A s53.3s 7A 544.40 7A 554.01 7A 553.35 7A 553.3s 7A s53.35 7A 5s3.35 7A 5s2.39 7A 554.01 7A ss2.39 7A s53.3s 7A 553.35 7A ss4.01 7A s54.01 7A ss3.35 7A 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V King King King King King King King King King King King King King King King Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers 4V 4V 4V 4V 4V 4V 4V 4Y 4V 4V 4V 4V 4V 4V 4V about:blank 5/1 8 312212021 King King King King King King King King King King King King Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers Laborers 553.3s 7A s52.39 7A 553.35 7A 5s3.3s 7A 552.39 7A s52.39 7A 553.35 7A 5s2.39 7A s53.35 7A 5s2.39 7A 552.39 7A 544.40 7A ss3.3s 7A 553.3s 7A ss3.35 7A ss2.39 7A 5s2.39 7A 552.39 7A ss3.3s 7A 547.48 7A 550.31 7A 552.39 7A ss3.35 7A 5129.67 7A 5134.70 7A s138.38 7A s144.08 7A s146.20 7A s151.30 7A s1s3.20 7A s15s.20 7A s157.20 7A 554.11 7A Ssa.rr 7A 553.35 7A 5s2.39 7A 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View 8Y View King Laborers Kins Laborers Kins Laborers about:blank Rigger/SignaI Person Rip Rap Person Rivet Buster Rodder Scaffotd Erector Scate Person Stoper (Over 20") Stoper Sprayer Spreader (Concrete) Stake Hopper Stock Piter Swinging Stage/ Boatswain Chair Tamper & Simitar Etectric, Air & Gas Operated Toots Tamper (Mul.tipte & Setf- propetted) Timber Person - Sewer (Lagger, Shorer & Cribber) Toolroom Person (at Jobsite) Topper Track Laborer Track Liner (Power) Traffic Control Laborer Traffic Control Supervisor Truck Spotter Tugger Operator Tunnel Work-Compressed Air Worker 0-30 psi Tunnel Work-Compressed Ai r Worker 30.01-44.00 psi Tunnel Work-Compressed Air Worker 44.01-54.00 psi Tunnel Work-Compressed Air Worker 54.01-60.00 psi Tunnel Work-Compressed Air Worker 60.01-64.00 psi Tunnel Work-Compressed Air Worker 64.01-68.00 psi Tunnet Work-Compressed Ai r Worker 68.01-70.00 psi Tunnel Work-Compressed Air Worker 70.01-72.00 psi Tunnel Work-Compressed Air Worker 72.01-74.00 psi Tunnet Work-Guage and Lock Tender Tunnet Work-Miner Vibrator Vinyl Seamer 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 4V 8Y View View View 8Y 8Y King King King King King King King King King 8Y View 8Y View 8Y View 8Y View 9C View 9C View 8Y View 8Y View 98 View Kins Laborers Kins Laborers King Laborers King Laborers Kine Laborers King Laborers Kins Laborers King Laborers Kins Laborers Laborers Laborers Laborers 9B 9B 9B 9B 9B 9B 9B 8Y 98 View View View View View View View View View 8Y View 8Y View 8Y View 6/18 King King King about:blank 312212021 about:blank Watchman Welder Welt Point Laborer Window Washer/Cteaner General Laborer & Topman Pipe Layer Landscape Construction / LandscaPing Or Ptanting Laborers Landscape Operator Groundskeeper Journey Level Journey Level Journey Level Journey Level Cabinet Assembly Etectrician Equipment Maintenance Ptumber Production Worker Too[ Maintenance Utitity Person Wetder Journey Level Crew Tender Crew Tender/Technician Hyperbaric Worker - Compressed Air Worker 0-30.00 PSt Hyperbaric Worker - Compressed Air Worker 30.01 - 44.00 PSr Hyperbaric Worker - Compressed Air Worker 44.01 - 54.00 PSI Hyperbaric Worker - Compressed Air Worker 54.01 - 60.00 Pst Hyperbaric Worker - Compressed Air Worker 60.01 - 64.00 PSI Hyperbaric Worker - Compressed Air Worker 64.01 - 68.00 PSI Hyperbaric Worker - Compressed Air Worker 68.01 - 70.00 Psr Hyperbaric Worker - Compressed Air Worker 70.0'l ' King King King King King King King Laborers Laborers Laborers Laborers Laborers - Underground Sewer & Water Laborers - Underground Sewer & Water La ndscapcleo nElf ucU o n Landscape_.lConslluEljsn Landscaps_.lMai n Ecnance Lathers Marble Setters Metat Fabrication (ln Shop). Mittwrigh! Modutar Buildingg Modular Buitdings Modular Buitdingg Modutar Buildingg Modular Buitding5 Modutar Buildingg Modutar Buildingg Modutar Buitdingg Painters Pite Driver Pite Driver Pite Driver Pite Driver Pite Driver Pile Driver Pite Driver Pile Driver Pile Driver Pile Driver s40.36 7A s53.35 7A 553.3s 7A 540.36 7A ss2.39 7A ss3.35 7A s40.36 7A s72.28 7A 517.87 564.94 sp 560.s7 7E s41.70 15F 566.44 7A 513.6e s13.69 s13.69 s13.69 s13.6e s13.69 513.6e s13.69 s4s.40 6z $6g.sr 7A 569.91 7A s80.76 7A s8s.76 7A 589.76 7A 594.76 7A 597.26 7A s102.26 7A 5104.26 7A 8Y View W View 8Y View 8Y View 8Y View 4V 4V 4V 4V 4V 4V 4V 3K t 1H 1N 114 4C ! ! t L ! L L L 28 4C 4C 4C 4C 4C 4C 4C 4C 4C 4C King King King King King King King King King King King King King King King King King King 8X View View View View View View View View View View View View View View View View View View 8Y View 8Y View View View View View View View King King King King King King King about:blank 5106.26 7A View 7118 3t2212021 King Pite Driver Pite Driver Ptasterers Ptayground & Park Equip_mg$ lnstatlers Plumbers & Pipefitters Power Equi pmen!-.lQpgators Power Equi p:rnenE_.lQperators Powe r Eq u i pmen!..lQps.ralefs Power Equiprnen!..lQperators Powe r Eq ui prnen!_.lqpe ralQE Powe r Eq ui p:rned!-Qpe rato rs Power EquipmenlLlQpelalors Power Eouioment Ooerators Powe r Eq ui ptrnenllQpe ratoE Power Equipmeg!-.1Qp€Iators Powe r Eq ui prn en:!_.lQpgalAls Power Equipmen!_.lQperators about:blank 72.00 PSt Hyperbaric Worker - Compressed Air Worker 72.01 ' 74.00 PSt Journey Level Journey Level Journey Level Journey Levet Asphatt Ptant Operators Assistant Engineer Barrier Machine (zipper) Batch Ptant Operator: concrete Bobcat Brokk - Remote Demolition Equipment Brooms Bump Cutter Cabteways Chipper Compressor Concrete Finish Machine - Laser Screed Concrete Pump - Mounted Or Traiter High Pressure Line Pump, Pump High Pressure Concrete Pump: Truck Mount With Boom Attachment Over 42 M Concrete Pump: Truck Mount With Boom Attachment Up To 42m Conveyors Cranes friction: 200 tons and over Cranes: 100 tons through 199 tons, or 150'of boom (inctuding jib with attachments) Cranes: 20 Tons Through 44 Tons With Attachments Cranes: 200 tons- 299 tons, or 250'of boom inctuding jib with attachments Cranes: 300 tons and over or 300'of boom inctuding jib with attachments Cranes: 45 Tons Through 99 Tons, Under 150'Of Boom (inctuding Jib With Attachments) Cranes: A-frame - 10 Tons And 5108.26 7A 4C King King King King King King King King King King s65.19 7A 561.67 ZA 513.6e 592.19 62 573.49 7A 569.12 7A s72.84 7A s72.84 7A 569.12 7A s69.12 7A 569.12 7A 572.84 7A 573.49 7A s72.84 7A 569.12 7A 569.17 7A s72.28 7A 573.49 7A 572.84 7A 572.28 s75.72 574.22 572.84 574.99 575.72 573.49 View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View View View View View 8X View View View 8X View 8X View 8X View 8X View 8X View 8X View View 4C 1R ! 1G 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K King King King King King King King Power Equiptrnen'!_lQperato6 King Power Equipment_.lQperators King Power Equipmen!-.lQpgalSrs 8X 8X King King King about:blank King Power Equipmen!-lQplalArs King Power Equipmen!_.lQperators King Power Equipmen!-lQperators King Power Equipmen!-.lQpratof5 King Power Equipme$-.lQpera!9l5 Power Eouioment Ooerators Power Eq ui p:rnen'LlQperatoE 7A 7A 7A 7A 7A 7A 7A 7A 8X 8XPower Eq ui glgn !_.1Qp€ rato rs 569.12 View 8/18 312212021 King Power Equipmen!-lQperators King PowerEquipmen!-.lQplratoE King Power Eq ui pmen!_.lQrcrators Power Eouioment OoeratorsKing about:blank Under Cranes: Friction cranes through 199 tons Cranes: through 19 tons with attachments, A-frame over 10 tons Crusher Deck Engineer/ Deck Winches (power) Derricks, On Buitding Work Dozers D-9 & Under Dritt Oiters: Auger Type, Truck Or Crane Mount Dritting Machine Elevator And Man-tift: Permanent And Shaft Type Finishing Machine, Bidwett And Gamaco & Simitar Equipment Forklift: 3000 Lbs And Over With Attachments Forktifts: Under 3000 Lbs. With Attachments Grade Engineer: Using Btue Prints, Cut Sheets, Etc G radechecker/ Stakeman GuardraiI Punch Hard Tail End Dump Articutating Off- Road Equipment 45 Yards. & Over Hard Tail End Dump Articutating Off-road Equipment Under 45 Yards Horizontat/ DirectionaI Dritt Locator Horizontat/ DirectionaI DritI Operator Hydratifts/ Boom Trucks Over 10 Tons Hydratifts/Boom Trucks, 1 0 Tons And Under Loader, Overhead 8 Yards. & Over Loader, Overhead, 6 Yards. But Not lncluding 8 Yards Loaders, Overhead Under 6 Yards Loaders, Ptant Feed Loaders: Elevating Type Bett Locomotives, At[ Material Transfer Device Mechanics, Att (teadmen - S0.50 Per Hour Over Mechanic) King King King King King King King King King King King King King King King King King King Power Equiptmg$-.lQpera!9rs King Power Equipmen!-.lQperatoE King Power Equip-men!-.Qprato6 King Power Equipmen!-.lQperators Powe r Eq ui p:m ent_.lQFIalo rs Power Eouioment Ooerators Power Eq ui pmen!-.l0rcIators King Power EquipmenllQPerators Power Eouioment Ooerators Power Eq ui pmen!_lQp€Iato rs Power Eouioment Ooerators Power Equip4en !-.lQperators Power Eouioment Ooerators Power Eq ui ptrn en!_.l9pla!ors Power Eq ui pmen!-lQperato.fs Power Eq ui ptrn en!_.lQpe rato rs Powe r Eq ui pm en!-.lQpgato rs Power Equi pmen!-.1QrcIators Power Eq ui prnen!-1Qp€ rato rs Power Eouioment Ooerators Power Eouioment Ooerators Powe r Eq ui pngn'!-l0pgal9fs Power Equi pmen!_.lQperators Power Equi pmen!_.lQpe rators Power Eouioment Ooerators 574.99 7A 572.28 7A 572.84 7A 572.84 7A 573.49 7A 572.28 7A s72.28 7A 574.22 7A 569.12 7A 572.84 7A 572.28 7A 569.12 7A 572.84 7A 569.12 7A 572.84 7A 573.49 7A s72.84 7A 572.28 7A 572.84 7A 577.28 7A 569.12 7A 574.22 7A 573.49 7A 572.84 7A 572.84 7A 572.28 7A 572.84 7A 572.84 7A 574.72 7A 3K 8X View 3K 8X View 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 8X 8X 8X 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View View View View 8X View 8X View 8X View 8X View 8X View View View View View View View King King King 8X 8X 8X 8X 8X 8X 8X View 8X View 8X View 8X View 8X View about:blank 9/1 I 312212021 King King Power Eouioment Ooerators Power Eouioment Ooerators about:blank Motor Patro[ Graders Mucking Machine, Mole, Tunnel Drill, Boring, Road Header And/or Shietd OiI Distributors, Btower Distribution & Mutch Seeding Operator Outside Hoists (Etevators And Mantifts), Air Tuggers, Strato Overhead, Bridge Type Crane: 20 Tons Through 44 Tons Overhead, Bridge Type: 100 Tons And Over Overhead, Bridge Type: 45 Tons Through 99 Tons Pavement Breaker Pile Driver (other Than Crane Mount) Ptant Oiter - Asphatt, Crusher Posthote Digger, Mechanical Power Ptant Pumps - Water Quad 9, Hd 41, D10 And Over Quick Tower - No Cab, Under 100 Feet ln Height Based To Boom Remote Control Operator On Rubber Tired Earth Moving Equipment Rigger and Bettman Rigger/Signal Person, Bettman (Certified) RoItagon Rolter, Other Than Plant Mix Rolter, Plant Mix Or Mutti-tift Materiats Roto-mitt, Roto-grinder Saws - Concrete Scraper, Setf Propetled Under 45 Yards Scrapers - Concrete & Carry Att Scrapers, Setf-propetted : 45 Yards And Over Service Engineers - Equipment Shotcrete/Gunite Equipment Shovet, Excavator, Backhoe, Tractors Under 15 Metric Tons Shovet, Excavator, Backhoe: Over 30 Metric Tons To 50 Metric Tons Shovet, Excavator, Backhoes, 573.49 573.49 569.12 57?..28 s72.84 574.22 s73.49 569.12 7A 572.84 7A 572.28 7A 569.12 7A 569."t2 7A 569.12 7A 573.49 7A 569.12 7A 573.49 7A 569.12 7A 572.28 7A s73.49 7A 569.12 7A s72.28 7A 572. 572. |tz. 572.28 7A 573.49 7A s72.28 7A 569.12 7A s72.28 7A 573.49 7A 8X View 8X View 8X View View View View View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8Xry 8X View 8X View 8X View 8X 8X 8X 8X 7A 7A 7A 7A 7A 7A 7A 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K King Power EquiPmen!-.lQp€ra!9rs King Power EquipmenllQPerators King Power EquiPmen!..lQpera!9rs King PowerEquip-!0gn!-.lQperators King Power EquiPmen!-..9pera!9rs Power Eouioment Ooerators Power EquipmenllQrcrators King King King King King King King King Power Eouioment Ooerators Power Eouioment Ooerators Power Eouioment Ooerators Power Equipmen!-.lQFrators Power Eouioment Ooerators Power Equi pmen!-.lQperators Power Equipmen!-.lQpgators Power Eouioment Ooerators 8X View 8X View 8X View 8X View 8X View 8X View King Power Equiptmen!..lQp€tators King King 7A 7A 7A 84 28 84 King King King King King King ng ng ng ng ng Power Equi pmenllQperators Power Eouioment Ooerators Power Eouioment Ooerators Power Equi pmen!-.lQpefators Power Eouioment Ooerators Power Eouioment Ooerators Power Eq ui pmenl!-.lQpfa!9fs Powe r Eq ui pm en!-.lQp3.f ato rs Power Eq ui pmen!_SperatoE Power Eq ui prnen!-.lQperators Powe r Eq ui ptrnen!-.lQp€fato rs King Power Equipme$-Qperators Ki Ki Ki Ki Ki King about:blank View 10/18 Power Eq uipmen!_.lQperatoE s72.84 7A 8X 3t2212021 King Power Equipmen!-.iQperators Power Eouioment ooerators Power Eouioment Ooerators Power Eouioment Ooerators about:blank Tractors: 15 To 30 Metric Tons Shovel, Excavator, Backhoes: Over 50 Metric Tons To 90 Metric Tons Shovet, Excavator, Backhoes: Over 90 Metric Tons Stipform Pavers Spreader, Topsider & Screedman Subgrader Trimmer Tower Bucket Elevators Tower Crane Up To 175' ln Height Base To Boom Tower Crane: over 175'through 250'in height, base to boom Tower Cranes: over 250'in height from base to boom Transporters, At[ Track Or Truck Type Trenching Machines Truck Crane Oiter/driver - 100 Tons And Over Truck Crane Oiter/Driver Under 100 Tons Truck Mount Portabte ConveYor Wetder Wheet Tractors, Farmat[ TYPe Yo Yo Pay Dozer Asphatt Plant Operators King King King 574.22 7A s74.99 7A 573.49 7A 573.49 7A 572.84 7A s72.28 7A 574.22 7A s74.99 7A s75.72 7A 573.49 7A 572.28 7A 572.84 7A 572.28 7A 572.84 7A 573.49 7A 569.12 7A 572.84 7A 573.49 7A 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View View View 8X View 8X View 8X View 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K King King King Power Eouioment Ooerators Power Equipmeni!_.lQperators Power Eouioment Ooerators Power Eouioment Ooerators Power Equipment lQrcrators Power Eouioment Ooerators Power Eouioment Ooerators Power Equipmen!-.lQperators Power EquipmenjllQperators Power Eouioment Ooerators- ljndersround Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equi pmen!-.lQperators-. Underground Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Underpround Sewer & Water Powe r Eq ui ptmen!-.lOps rato rs -. ljndersround Sewer & Water Power Eouioment Ooerators- ljndersround Sewer & Water Power Eq uipmen!-.l0pslators'. lJndersround Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Equi pmen!-.lQrcratols: ljndercround Sewer & Water Powe r Eq ui ptnen!-]ope rators'. Underground Sewer & Water Assistant Engineer s69.12 7A Barrier Machine (zipper)572.84 7A Batch Plant Operator, Concrete Bobcat 577.84 7A 569.12 7A Brokk - Remote Demotition Equipment Brooms 569.12 7A 569.12 7A Bump Cutter 572.84 7A Cabteways 573.49 7A Chipper 572.84 7A Compressor 569.12 Concrete Finish Machine - Laser Screed King Power Equipmen!-.10p€rators King Power Equipmenlllgperators King Power Equiptrnen!-.lQp€ra!9rs 8X 8X King Power EquipmenlQPerators King King King King King King King King King King King King King King King King King King 8X View 8X View 8X View 8X View 8X View 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X 7A 7A 8X View View View View View View View View View View View 11118about:blank s69.12 312212021 King King King King King King King King King King King King King King King King King King King King King King Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Powe r Eq ui p_men!_.lQ ps ratoIs: Underground Sewer & Water Power Equipment Operators-. Underground Sewer & Water Power Eouioment Ooerators- Underoround Sewer & Water Power Equipnnent Operators- Undersround Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eq ui plnent Operators-. UnelCfground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Equipment -Qperators-. Underground Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Undercround Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equipment Oplators-. ljndersround Sewer & Water Power Equipnent Op€rators-. Undersround Sewer & Water Power Equipment OpsIatoIS: Underground Sewer & Water Power Eouioment Ooerators- Underground Sewer ft Water Power Eoui oment Ooerators- ljnderpround Sewer & Water Power Equi pJnent OperatoE Underground Sewer & Water Power Equiplnent OrcE!!qI!:. Underground Sewer & Water about:blank Concrete Pump - Mounted Or 572.28 7A Traiter High Pressure Line Pump, Pump High Pressure Concrete Pump: Truck Mount 573.49 7A With Boom Attachment Over 42 M Concrete Pump: Truck Mount 572.84 7A With Boom Attachment Up To 42m Conveyors 572.28 7A Cranes friction: 200 tons and over Cranes: 100 tons through 199 tons, or 150'of boom (inctuding jib with attachments) Cranes: 20 Tons Through 44 Tons With Attachments Cranes: 200 tons- 299 tons, or 250' of boom inctuding jib with attachments Cranes: 300 tons and over or 300'of boom inctuding jib with attachments Cranes: 45 Tons Through 99 Tons, Under 150'Of Boom (inctuding Jib With Attachments) Cranes: A-frame - 10 Tons And Under Cranes: Friction cranes through 199 tons Cranes: through 19 tons with attachments, A-frame over 10 tons Crusher Deck Engineer/ Deck Winches (power) Derricks, On Building Work Dozers D-9 & Under Dril[ Oiters: Auger Type, Truck Or Crane Mount Dritting Machine Elevator And Man-[ift: Permanent And Shaft Type Finishing Machine, Bidwett And Gamaco & Simitar Equipment Forklift: 3000 Lbs And Over With Attachments 575.72 7A 574.22 7A s72.84 7A 574.99 7A 575.72 7A 573.49 7A 569.12 7A 574.99 7A s72.28 7A 572.84 7A s72.84 7A 573.49 7A 572.28 7A 572.28 7A s74.22 7A 569.12 7A 572.84 7A 572.28 7A 8X View 8X View View View View View View View View View View View View View View View View View View View View View 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 12118about:blank 3t2212021 King Power Equi pmenllQPe[ators'. Underground Sewer & Water Power Eq uipment OP€fetors -. Underground Sewer & Water Power Equiprnent OPeratols-. Underground Sewer & Water Power Equipment OPerators-. Underground Sewer & Water Powe r Eq ui pmen!-.lQPgators -. Undefground Sewer & Water Power EquipmenllQps@. Underground Sewer & Water Power Equi pmen!-.lQPerators-. Underground Sewer & Water Power Eq ui pmen!-APgators -. Underground Sewer & Water Power Equipmen!-gperators-. Undclground Sewer & Water Power Equi pment OPgators-. Underground Sewer & Water Power Equipnlent OPeralgrs-. Underground Sewer & Water Powe r Eq ui pICn!-Q p€ ratoE UnclCfground Sewer & Water Power Equipment loPerators-. Underground Sewer & Water Power Equipment OPerators-. Underground Sewer & Water Power Equipment Operators-. Undglground Sewer & Water Powe r Eq ui pm en!-QPgatog Underground Sewer & Water Power Eq ui pmen!-.lQPerators-. Underground Sewer & Water Power Equipment OP€Gtors-. Uglsfground Sewer & Water Powe r Eq ui p-m en!-QP-qatoe. Underground Sewer & Water Power Eq ui pmen'!-.!0PsIators-. Underground Sewer & Water Power Equi pmeE!-.loPerators-. Underground Sewer & Water Power Equi pmen!-.lQPerators-. Underground Sewer & Water Power Eq ui pilen!-QPe ra!9I5: Unelgfground Sewer & Water Powe r Eq ui pn1e n!-.lQp-Crators'. Underground Sewer & Water Power Eq ui pJDen!-.lQpe ratoff. about:blank Forklifts: Under 3000 Lbs. With Attachments Grade Engineer: Using Btue Prints, Cut Sheets, Etc G radechecker/ Stakeman Locomotives, Atl Material Transfer Device Mechanics, Atl (teadmen' 50.50 Per Hour Over Mechanic) Motor Patrol Graders Mucking Machine, Mole, Tunnel Dritt, Boring, Road Header And/or Shietd Oil, Distributors, Blower Distribution & Mutch Seeding Operator Outside Hoists (Elevators And Mantifts), Air Tuggers, Strato Overhead, Bridge Type Crane: 20 Tons Through 44 Tons Overhead, Bridge TYPe: 100 Tons And Over Overhead, Bridge TyPe: 45 569.12 7A 3K 8X View 572.84 7A 3K 8X ViewKing King King King King King King King King King King King King King King King King King King King King King King King about:blank 56e.12 Guardrait Punch 572.84 Hard Tait End Dump 573.49 7A Articulating Off- Road Equipment 45 Yards. & Over Hard Tait End Dump 572-84 7A Articutating Off-road Equipment Under 45 Yards Horizontat/Directional Dri[[ 572.28 7A Locator Horizontat/Directional Dritl 572.84 7A Operator Hydral,ifts/Boom Trucks Over 572.28 7A 10 Tons Hydratifts/Boom Trucks, 10 569.12 7A Tons And Under Loader, Overhead 8 Yards. & 574.22 7A Over Loader, Overhead, 6 Yards. But 573.49 7A Not lnctuding 8 Yards Loaders, Overhead Under 6 572.84 7A Yards Loaders, Ptant Feed 572.84 7A Loaders: Etevating Type Bett 572.28 7A 572.84 7A s72.84 7A 574.72 7A 573.49 7A 573.49 7A 569.12 7A 572.28 7A 572.84 7A 574.22 7A 573.49 7A View View View View View View View View View View View View View View View View View View View View View View View 13118 7A 7A 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 312212021 King King about:blank Underground Sewer & Water Power Eouioment Ooerators- Underpround Sewer & Water Powe r Eq ui pn0gn !_.lQp€Ia!9f5:. Underground Sewer & Water Power Eouioment Operators- Undersround Sewer & Water Power Equi pmen!-.lQperators-. Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equipmen!-.lQpsrators-. Underground Sewer & Water Power Eouioment Ooerators- Unclgfground Sewer & Water Power Equipmen!_.lQPerators-. Undersround Sewer & Water Power Eouioment Ooerators- ljnderqround Sewer & Water Power Eq ui pmen!_lQpgators-. Underground Sewer & Water Power Equi pmen!_.!QPeralqrs-. Underground Sewer & Water Power Equi pmenllQPerators-. Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equipmen!..lQPgators-. Undgfground Sewer & Water Power Eouioment Ooerators- Unclefground Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eq ui pmen!_.lQpslators-. Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eoui oment Ooerators- Undersround Sewer & Water Power Equi pmenlQpslators-. Underground Sewer & Water Power Eq ui p-me n!-.lQps rato rs -. Underground Sewer & Water Power Eouioment Ooerators- about:blank Tons Through 99 Tons Pavement Breaker 569.12 7A 3K Pite Driver (other Than Crane Mount) Ptant Oiter - Asphalt, Crusher 572.84 7A s72.28 7A Posthote Digger, Mechanical 569.12 7A Power Ptant s69.12 7A Pumps - Water s69.17 7A Quad 9, Hd 41, D10 And Over 573.49 7A Quick Tower - No Cab, Under 100 Feet ln Height Based To Boom Remote Control Operator On Rubber Tired Earth Moving Equipment Rigger and Bettman 569.12 7A s73.49 7A s69.12 7A Rigger/SignalPerson, Bettman 572.28 (Certified) Rottagon 573.49 Ro[[er, Other Than Ptant Mix 569.12 Rotter, Ptant Mix Or Multi'tift Materiats Roto-mitl, Roto-grinder 572.78 572.84 Saws - Concrete 572.28 Scraper, Setf Propetted Under 572.84 45 Yards Scrapers - Concrete & Carry Att 572.28 Scrapers, Setf-propetted: 45 573.49 Yards And Over Service Engineers - Equipment 572.28 Shotcrete/GuniteEquipment 569.12 Shovel, Excavator, Backhoe, Tractors Under 15 Metric Tons Shovet, Excavator, Backhoe: Over 30 Metric Tons To 50 Metric Tons Shovel, Excavator, Backhoes, Tractors: 15 To 30 Metric Tons Shovet, Excavator, Backhoes: 572.28 573.49 572.84 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 7A 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 3K 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 8X View 14t18 574.22 312212021 King King King King King King King King King King King King King King King King King King King King King King King King King King King King about:blank ljnderpround Sewer & Water Power Eouioment Ooerators- ljndersround Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eouioment Ooerators- ljndersround Sewer & Water Power Equi pmenlllQpefators-. Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Eq uipmenl-9Psfators-. Underground Sewer & Water Power Eouioment Ooerators- lJndersround Sewer & Water Power Eq ui ptrn en!-.lQPsf ators -. Underground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equi pmentlQperators-. Undgfground Sewer & Water Power Eouioment Ooerators- ljndersround Sewer & Water Power Eq ui pm en!-.lQpsfa!9lf. Undgfground Sewer & Water Power Eouioment Ooerators- Undersround Sewer & Water Power Equi pmen!-.lQperators-. Underground Sewer & Water Power Line Ctearance Tree Trimmers Power Line Ctearance Tree Trimmers Power Line Ctearance Tree Trimmers Power Line Ctearance Tree Trimmers Power Line Ctearance Tree Trimmers Refrigeration & Air Conditioning Mechanics about:blank Over 50 Metric Tons To 90 Metric Tons Shovet, Excavator, Backhoes: Over 90 Metric Tons Stipform Pavers Spreader, Topsider & Screedman Subgrader Trimmer Tower Bucket Etevators Tower Crane Up To 175' ln Height Base To Boom Tower Crane: over 175'through 250'in height, base to boom Tower Cranes: over 250'in height from base to boom Transporters, At[ Track Or Truck Type Trenching Machines Truck Crane Oiter/driver - 100 Tons And Over Truck Crane Oiler/Driver Under 100 Tons Truck Mount Portable Conveyor Welder Wheel Tractors, Farmatl Type Yo Yo Pay Dozer Journey Level ln Charge Spray Person Tree Equipment Operator Tree Trimmer Tree Trimmer Groundperson 574.99 7A s73.49 7A 573.49 7A s72.84 7A 572.28 7A 574.22 7A 574.99 7A 575.72 7A 573.49 7A 572.28 7A s72.84 7A 572.28 7A 572.84 7A 573.49 7A 569.12 7A 572.84 7A 555.03 5A 552.24 sA 5ss.03 5A 549.21 5A 537.47 54 5gz.or 6z s60.57 7E 536.44 546.64 s64.94 7A s36.36 548.80 Journey Level Residential Brick Mason Journey Level Residential Carpente6 Journey Level Residential Cement Masons Journey Level Residential Drvwatl App-Ucalgrs Journey Levet Residential Drvwatl Tapl6 Journey Levet Residential Etectricians Journey Level 3K 8X View 3K 8X View View View View View View View View View View View View View View View View View View View View 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X 8X View View View View View View View 1 5/18 312212021 King King ResidentiaI Glaziers Residentia[ I nsulation Aoolicators Residential Laborers Residential Marbte Setters ResidentiaI Painters Residential Ptumbers & Pioefitters Residentiat Refrigeration & Air Conditioning Mechanics Residential Sheet Metal Workers Residential Soft Ftoor LayCE Residential SpjrcL Fitters (Fire Protection) Residential Stone Masons Residential Terrazzo Workers ResidentiaI TerrazzolTite Finishers Residential Tile Setters Roofers Roofers Sheet Metal Workers shipEilgling ft ship ReFjI Shi pbuilding e Ship-Repa ir Shipbuitdjng e Ship-fupail Shipiuilding & Ship ReEiI Shipbuitding & Ship Repijl Shi pluilding e Ship-Repa lr Shi pbui tding e Shipjspail Shiplujldjng e Shi p-Repa ir Shipiuilelng e Ship Repair Shi pluj-tdjng & shi p-Repa ir Shipbul([1g ft ShitRepair Shiplujlding & Shi p-Repa ir Shipluilding e Ship Repajl Shipluilding & Ship Repajl about:blank Journey Level Journey Level Journey Level Journey Level Journey Levet Journey Level Journey Level Journey Level Journey Level Journey Level Journey Levet Journey Level Journey Level Journey Level Journey Level Using lrritable Bituminous Materiats Journey Levet (Fietd or Shop) New Construction Boitermaker New Construction CarPenter New Construction Crane Operator New Construction Electrician New Construction Heat & Frost lnsutator New Construction Laborer New Construction Machinist New Construction OPerating Engineer New Construction Painter New Construction PiPefitter New Construction Rigger New Construction Sheet Metal New Construction ShiPfitter New Construction Warehouse/Teamster New Construction Wetder / Burner Ship Repair Boitermaker Ship Repair Carpenter Ship Repair Crane Operator Ship Repair Electrician Ship Repair Heat & Frost lnsutator s28.e3 528.1 8 529.73 s27.38 523.47 s92.19 6Z s87.01 6Z s89.61 7F s51.91 54 553.04 sC 560.57 7E 555.71 7E 524.39 s21.04 ss7.30 5A 560.30 5A s89.61 7F s38.54 7V s38.54 7V 538.s4 7V 538.54 7V 538.54 TV s3A.Sa 7V s47.35 7X 547.35 7X 545.06 T{ 547.42 7X 579.43 5J t 1 ! l_ t 1G 1G 1E 3J 2R 1N 1N t ! 3H 3H 1E L ! t L 4H View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View View King King King King King King King King King King King King King King King King King King King King King King King King King King King King King 7V 5J 54 43 Sgs 5ts 7V 7V 7V 7V 7V 7V 7V 538.54 53s. s+ 538.54 s38.s4 538.s4 534. s+ S38.54 4J 4J 4K 4J 4H King King King King King t L t L L t t 7 L tKing Shipiuitding & Ship-Rcpajl Shipluj_Ldjng e Shi p-Repa ir Shipluildjng & Ship Repall Shipbuitding & Ship-Repa ir Shipluildjng & Ship ReFjI Shi pburldrng e Shi p-Repa ir about:blank 16118 3t2212021 King King King King King King King King King King King King King King King King King King King King shiplujldlng & Ship Repsjl shipbuildjng e Ship- ReFjI Shipbuitcling e Ship- Scpail Shiplujlding & Ship-Repail Shipbuitding & Ship Repajl Shi pluilding e Shi p-Repa ir Shi pbu llgling & Shi p-Rep3il Shipiuitding e Ship RePajI Shiplujlding e Ship RePajI Sign Makers & lnstatters {Etectricat). Sign Makers & lnstatters (Non- Etectricat). Soft Floor Layers Solar Controts For Windows Sorinkler Fitters (Fire Protection). Stage Rigging Mechanics (Non Structura[). Stone Masons Street And Parking Lot SweeP3l Workers Surveysfg Surveyors Surveygfs Tetecommunication Technicians Tetephone Line Construc Outside Ielepnone tine Constru 0utside Tetephone Line Construc Outside @pnone tine Constru Outside Terrazzo Workers Tite Setters Tite, Marble & Terrazzo Finishers Traffic Controt Stri psfg Truck Drivers Truck Drivers Truck Drivers Truck Drivers Truck Drivers Truck Drivers - Ready-.tMix Wet[ Dritters & lrrigation PumP- lnstatters about:blank Ship Repair Laborer Ship Repair Machinist Ship Repair Operating Engineer Ship Repair Painter Ship Repair Pipefitter Ship Repair Rigger Ship Repair Sheet Metal Ship Repair Shipwright Ship Repair Warehouse / Teamster Journey Level Journey Levet Journey Level Journey Level Journey Level Journey Level Journey Level Journey Level Assistant Construction Site Surveyor Chainman Construction Site SurveYor Journey Level Cabte Spticer Hote Digger/Ground Person Tetephone Equipment OPerator (Light) Tetephone Lineperson Journey Level Journey Level Finisher Journey Level Asphatt Mix Over 16 Yards Asphatt Mix To 16 Yards Dump Truck Dump Truck & Traiter Other Trucks Transit Mix lrrigation Pump lnstatter 547.35 7X 547.35 7X 545.06 7'( 547.35 7X 547.35 7X 547.35 7X s47.3s 7X 547.3s 7K 545.06 T'( 551.s6 q s33.20 q Ssr.sr 5A s13.69 585.89 sC 513.6e soo.sz 7E s1e.09 572.28 7A 569.12 7A 573.49 7A ss3.s7 7E 537.40 5A 525.04 5A 531.22 sA s35.34 sA 555.71 7E s55.71 7E 546.54 7E 549.13 7A s64.s5 sp 563.71 5p 563.71 5p 564.5s sp s64.s5 5p s64.55 sp 517.71 View View View View View View View View View View View View View View View View View 8X View 8X View 8X View View View View View View View View View 4J 4J 4K 4J 4J 4J 4J 4J 4K King King King King King King t L 1 3J ! 1X 1N ! 3K 3K 3K 1E ZB 2B 28 2B 1N 1N 1N 1K 4Y 4Y 4Y 4Y 4Y 4Y 1 King ng ng Ki Ki ng ng ng King King King King Ki Ki Ki View 8L View 8L View 8L View 8L View 8L View 8L View View about:blank 17t18 3t22t2021 King King about:blank Wet[ Drilters & lrrigation Pump- Oiter lnstatters Wett Dritters & lrrigation Pump Wett Dritter lnstaIters 513.6e s18.00 L 1 View View about:blank 18/18 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Overtime calculations are based on the hourly rate actually paid to the worker. On public works projects, the hourly rate must be not less than the prevailing rate of wage minus the hourly rate of the cost of fringe benefits actually provided for the worker. ALL HOURS WORKED IN EXCESS OF EIGHT (8) HOURS PER DAY OR FORTY (40) HOURS PER WEEK SHALL BE PAID AT ONE AND ONE-HALF TIMES THE HOURLY RATE OF WAGE. B. All hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. C. The first two (2) hours after eight (8) regular hours Monday through Friday and the first ten (10) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All other overtime hours and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. D. The first two (2) hours before or after a five -eight (8) hour workweek day or a four -ten (10) hour workweek day and the first eight (8) hours worked the next day after either workweek shall be paid at one and one-half times the hourly rate of wage. All additional hours worked and all worked on Sundays and holidays shall be paid at double the hourly rate of wage. E. The first two (2) hours after eight (8) regular hours Monday through Friday and the first eight (8) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All other hours worked Monday through Saturday, and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. F. The first two (2) hours after eight (8) regular hours Monday through Friday and the first ten (10) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All other overtime hours worked, except Labor Day, shall be paid at double the hourly rate of wage. All hours worked on Labor Day shall be paid at three times the hourly rate of wage. G. The first ten (10) hours worked on Saturdays and the first ten (10) hours worked on a fifth calendar weekday in a four - ten hour schedule, shall be paid at one and one-half times the hourly rate of wage. All hours worked in excess of ten (10) hours per day Monday through Saturday and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. H. All hours worked on Saturdays (except makeup days if work is lost due to inclement weather conditions or equipment breakdown) shall be paid at one and one-half times the hourly rate of wage. All hours worked Monday through Saturday over twelve (12) hours and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. I. All hours worked on Sundays and holidays shall also be paid at double the hourly rate of wage. The first two (2) hours after eight (8) regular hours Monday through Friday and the first ten (10) hours on Saturday shall be paid atone and one-half times the hourly rate of wage. All hours worked over ten (10) hours Monday through Saturday, Sundays and holidays shall be paid at double the hourly rate of wage. K. All hours worked on Saturdays and Sundays shall be paid at one and one-half times the hourly rate of wage. All hours worked on holidays shall be paid at double the hourly rate of wage. M. All hours worked on Saturdays (except makeup days if work is lost due to inclement weather conditions) shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. N. All hours worked on Saturdays (except makeup days) shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. 1of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Continued O. The first ten (10) hours worked on Saturday shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays, holidays and after twelve (12) hours, Monday through Friday and after ten (10) hours on Saturday shall be paid at double the hourly rate of wage. P. All hours worked on Saturdays (except makeup days if circumstances warrant) and Sundays shall be paid at one and one-half times the hourly rate of wage. All hours worked on holidays shall be paid at double the hourly rate of wage. Q. The first two (2) hours after eight (8) regular hours Monday through Friday and up to ten (10) hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked in excess of ten (10) hours per day Monday through Saturday and all hours worked on Sundays and holidays (except Christmas day) shall be paid at double the hourly rate of wage. All hours worked on Christmas day shall be paid at two and one-half times the hourly rate of wage. R. All hours worked on Sundays and holidays shall be paid at two times the hourly rate of wage. U. All hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays (except Labor Day) shall be paid at two times the hourly rate of wage. All hours worked on Labor Day shall be paid at three times the hourly rate of wage. V. All hours worked on Sundays and holidays (except Thanksgiving Day and Christmas day) shall be paid at one and one-half times the hourly rate of wage. All hours worked on Thanksgiving Day and Christmas day shall be paid at double the hourly rate of wage. W. All hours worked on Saturdays and Sundays (except make-up days due to conditions beyond the control of the employer)) shall be paid at one and one-half times the hourly rate of wage. All hours worked on holidays shall be paid at double the hourly rate of wage. X. The first four (4) hours after eight (8) regular hours Monday through Friday and the first twelve (12) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All hours worked over twelve (12) hours Monday through Saturday, Sundays and holidays shall be paid at double the hourly rate of wage. When holiday falls on Saturday or Sunday, the day before Saturday, Friday, and the day after Sunday, Monday, shall be considered the holiday and all work performed shall be paid at double the hourly rate of wage. Y. All hours worked outside the hours of 5:00 am and 5:00 pm (or such other hours as may be agreed upon by any employer and the employee) and all hours worked in excess of eight (8) hours per day (10 hours per day for a 4 x 10 workweek) and on Saturdays and holidays (except labor day) shall be paid at one and one-half times the hourly rate of wage. (except for employees who are absent from work without prior approval on a scheduled workday during the workweek shall be paid at the straight -time rate until they have worked 8 hours in a day (10 in a 4 x 10 workweek) or 40 hours during that workweek.) All hours worked Monday through Saturday over twelve (12) hours and all hours worked on Sundays and Labor Day shall be paid at double the hourly rate of wage. Z. All hours worked on Saturdays and Sundays shall be paid at one and one-half times the hourly rate of wage. All hours worked on holidays shall be paid the straight time rate of pay in addition to holiday pay. 2of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Continued 2. ALL HOURS WORKED IN EXCESS OF EIGHT (8) HOURS PER DAY OR FORTY (40) HOURS PER WEEK SHALL BE PAID AT ONE AND ONE-HALF TIMES THE HOURLY RATE OF WAGE. B. All hours worked on holidays shall be paid at one and one-half times the hourly rate of wage. F. The first eight (8) hours worked on holidays shall be paid at the straight hourly rate of wage in addition to the holiday pay. All hours worked in excess of eight (8) hours on holidays shall be paid at double the hourly rate of wage. M. This code appears to be missing. All hours worked on Saturdays, Sundays and holidays shall be paid at double the hourly rate of wage. O. All hours worked on Sundays and holidays shall be paid at one and one-half times the hourly rate of wage. R. All hours worked on Sundays and holidays and all hours worked over sixty (60) in one week shall be paid at double the hourly rate of wage. U. All hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked over 12 hours in a day or on Sundays and holidays shall be paid at double the hourly rate of wage. ALL HOURS WORKED IN EXCESS OF EIGHT (8) HOURS PER DAY OR FORTY (40) HOURS PER WEEK SHALL BE PAID AT ONE AND ONE-HALF TIMES THE HOURLY RATE OF WAGE. F. All hours worked on Saturday shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sunday shall be paid at two times the hourly rate of wage. All hours worked on paid holidays shall be paid at two and one-half times the hourly rate of wage including holiday pay. H. All work performed on Sundays between March 16th and October 14th and all Holidays shall be compensated for at two (2) times the regular rate of pay. Work performed on Sundays between October 15th and March 15th shall be compensated at one and one half (1-1/2) times the regular rate of pay. All hours worked between the hours of 10:00 pm and 5:00 am, Monday through Friday, and all hours worked on Saturdays shall be paid at a one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. K. Work performed in excess of eight (8) hours of straight time per day, or ten (10) hours of straight time per day when four ten (10) hour shifts are established, or forty (40) hours of straight time per week, Monday through Friday, or outside the normal 5 am to 6pm shift, and all work on Saturdays shall be paid at one and one-half times the hourly rate of wage. All work performed after 6:00 pm Saturday to 5:00 am Monday and Holidays, and all hours worked in excess of twelve (12) hours in a single shift shall be paid at double the hourly rate of wage. After an employee has worked eight (8) hours at an applicable overtime rate, all additional hours shall be at the applicable overtime rate until such time as the employee has had a break of eight (8) hours or more. When an employee returns to work without at least eight (8) hours time off since their previous shift, all such time shall be a continuation of shift and paid at the applicable overtime rate until he/she shall have the eight (8) hours rest period. 4. ALL HOURS WORKED IN EXCESS OF EIGHT (8) HOURS PER DAY OR FORTY (40) HOURS PER WEEK SHALL BE PAID AT ONE AND ONE-HALF TIMES THE HOURLY RATE OF WAGE. A. All hours worked in excess of eight (8) hours per day or forty (40) hours per week shall be paid at double the hourly rate of wage. All hours worked on Saturdays, Sundays and holidays shall be paid at double the hourly rate of wage. 3of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Continued 4. C. On Monday through Friday, the first four (4) hours of overtime after eight (8) hours of straight time work shall be paid at one and one half (1-1/2) times the straight time rate of pay, unless a four (4) day ten (10) hour workweek has been established. On a four (4) day ten (10) hour workweek scheduled Monday through Thursday, or Tuesday through Friday, the first two (2) hours of overtime after ten (10) hours of straight time work shall be paid at one and one half (1-1/2) times the straight time rate of pay. On Saturday, the first twelve (12) hours of work shall be paid at one and one half (1-1/2) times the straight time rate of pay, except that if the job is down on Monday through Friday due to weather conditions or other conditions outside the control of the employer, the first ten (10) hours on Saturday may be worked at the straight time rate of pay. All hours worked over twelve (12) hours in a day and all hours worked on Sunday and Holidays shall be paid at two (2) times the straight time rate of pay. D. All hours worked in excess of eight (8) hours per day or forty (40) hours per week shall be paid at double the hourly rate of wage. All hours worked on Saturday, Sundays and holidays shall be paid at double the hourly rate of pay. Rates include all members of the assigned crew. EXCEPTION: On all multipole structures and steel transmission lines, switching stations, regulating, capacitor stations, generating plants, industrial plants, associated installations and substations, except those substations whose primary function is to feed a distribution system, will be paid overtime under the following rates: The first two (2) hours after eight (8) regular hours Monday through Friday of overtime on a regular workday, shall be paid at one and one-half times the hourly rate of wage. All hours in excess of ten (10) hours will be at two (2) times the hourly rate of wage. The first eight (8) hours worked on Saturday will be paid at one and one-half (1-1/2) times the hourly rate of wage. All hours worked in excess of eight (8) hours on Saturday, and all hours worked on Sundays and holidays will be at the double the hourly rate of wage. All overtime eligible hours performed on the above described work that is energized, shall be paid at the double the hourly rate of wage. E. The first two (2) hours after eight (8) regular hours Monday through Friday and the first eight (8) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All other hours worked Monday through Saturday, and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. On a four -day, ten-hour weekly schedule, either Monday thru Thursday or Tuesday thru Friday schedule, all hours worked after ten shall be paid at double the hourly rate of wage. The Monday or Friday not utilized in the normal four - day, ten hour work week, and Saturday shall be paid at one and one half (1'h) times the regular shift rate for the first eight (8) hours. All other hours worked Monday through Saturday, and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. G. All hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked Monday through Saturday over twelve (12) hours and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. H. The first two (2) hours after eight (8) regular hours Monday through Friday and the first eight (8) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. All other overtime hours worked, except Labor Day, and all hours on Sunday shall be paid at double the hourly rate of wage. All hours worked on Labor Day shall be paid at three times the hourly rate of wage. I. The First eight (8) hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked in excess of eight (8) per day on Saturdays shall be paid at double the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. 4of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Continued 4. J. The first eight (8) hours worked on a Saturday shall be paid at one and one-half times the hourly rate of wage. All hours worked in excess of eight (8) hours on a Saturday shall be paid at double the hourly rate of wage. All hours worked over twelve (12) in a day, and all hours worked on Sundays and Holidays shall be paid at double the hourly rate of wage. K. All hours worked on a Saturday shall be paid at one and one-half times the hourly rate of wage, so long as Saturday is the sixth consecutive day worked. All hours worked over twelve (12) in a day Monday through Saturday, and all hours worked on Sundays and Holidays shall be paid at double the hourly rate of wage. L. The first twelve (12) hours worked on a Saturday shall be paid at one and one-half times the hourly rate of wage. All hours worked on a Saturday in excess of twelve (12) hours shall be paid at double the hourly rate of pay. All hours worked over twelve (12) in a day Monday through Friday, and all hours worked on Sundays shall be paid at double the hourly rate of wage. All hours worked on a holiday shall be paid at one and one-half times the hourly rate of wage, except that all hours worked on Labor Day shall be paid at double the hourly rate of pay. U. The first four (4) hours after eight (8) regular hours Monday through Friday and the first twelve (12) hours on Saturday shall be paid at one and one-half times the hourly rate of wage. (Except on makeup days if work is lost due to inclement weather, then the first eight (8) hours on Saturday may be paid the regular rate.) All hours worked over twelve (12) hours Monday through Saturday, and all hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. V. Work performed in excess of ten (10) hours of straight time per day when four ten (10) hour shifts are established or outside the normal shift (5 am to 6pm), and all work on Saturdays, except for make-up days shall be paid at time and one-half (1 ''/2) the straight time rate. In the event the job is down due to weather conditions, then Saturday may, be worked as a voluntary make-up day at the straight time rate. However, Saturday shall not be utilized as a make-up day when a holiday falls on Friday. All work performed on Sundays and holidays and work in excess of twelve (12) hours per day shall be paid at double (2x) the straight time rate of pay. After an employee has worked eight (8) hours at an applicable overtime rate, all additional hours shall be at the applicable overtime rate until such time as the employee has had a break of eight (8) hours. When an employee returns to work without a break of eight (8) hours since their previous shift, all such time shall be a continuation of shift and paid at the applicable overtime rate until such time as the employee has had a break of eight (8) hours. W. All hours worked on Saturdays (except makeup days if work is lost due to inclement weather conditions) shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. When an employee returns to work without at least eight (8) hours time off since their previous shift, all such time shall be a continuation of shift and paid at the applicable overtime rate until such time as the employee has had a break of eight (8) hours. 5of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Overtime Codes Continued 4. X. All hours worked on Saturdays shall be paid at one and one-half times the hourly rate of wage. All hours worked on Sundays and holidays shall be paid at double the hourly rate of wage. Work performed outside the normal shift of 6 am to 6pm shall be paid at one and one-half the straight time rate, (except for special shifts or three shift operations). All work performed on Sundays and holidays shall be paid at double the hourly rate of wage. Shifts may be established when considered necessary by the Employer. The Employer may establish shifts consisting of eight (8) or ten (10) hours of work (subject to WAC 296-127-022), that shall constitute a normal forty (40) hour work week. The Employer can change from a 5-eight to a 4-ten hour schedule or back to the other. All hours of work on these shifts shall be paid for at the straight time hourly rate. Work performed in excess of eight hours (or ten hours per day (subject to WAC 296-127-022) shall be paid atone and one- half the straight time rate. When due to conditions beyond the control of the Employer, or when contract specifications require that work can only be performed outside the regular day shift, then by mutual agreement a special shift may be worked at the straight time rate, eight (8) hours work for eight (8) hours pay. The starting time shall be arranged to fit such conditions of work. When an employee returns to work without at a break of eight (8) hours since their previous shift, all such time shall be a continuation of shift and paid at the applicable overtime rate until such time as the employee has had a break of eight (8) hours. Y. Work performed in excess of eight (8) hours of straight time per day, or ten (10) hours of straight time per day when four ten (10) hour shifts are established, or forty (40) hours of straight time per week, Monday through Friday, or outside the normal shift, and all work on Saturdays shall be paid at time and one-half the straight time rate. All work performed after 6:00 pm Saturday to 6:00 am Monday and holidays shall be paid at double the straight time rate of pay. Any shift starting between the hours of 6:00 pm and midnight shall receive an additional one dollar ($1.00) per hour for all hours worked that shift. After an employee has worked eight (8) hours at an applicable overtime rate, all additional hours shall be at the applicable overtime rate until such time as the employee has had a break of eight (8) hours or more. Z. All hours worked between the hours of 6:00 pm and 6:00 am, Monday through Saturday, shall be paid at a premium rate of 20% over the hourly rate of wage. Work performed on Sundays may be paid at double time. All hours worked on holidays shall be paid at double the hourly rate of wage. 11. ALL HOURS WORKED IN EXCESS OF EIGHT (8) HOURS PER DAY OR FORTY (40) HOURS PER WEEK SHALL BE PAID AT ONE AND ONE-HALF TIMES THE HOURLY RATE OF WAGE. A. The first ten (10) hours worked on Saturday and all hours worked on holidays shall be paid at one and one-half times the hourly rate of wage. All hours worked over twelve (12) hours Monday through Saturday, and all hours worked on Sundays shall be paid at double the hourly rate of wage. After an employee has worked eight (8) hours, all additional hours worked shall be paid at the applicable overtime rate until such time as the employee has had a break of eight (8) hours or more. 6of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Holiday Codes A. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, and Christmas Day (7). B. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, the day before Christmas, and Christmas Day (8). C. Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (8). D. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday and Saturday after Thanksgiving Day, And Christmas Day (8). H. Holidays: New Year's Day, Memorial Day, Independence Day, Thanksgiving Day, the Day after Thanksgiving Day, And Christmas (6). I. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, and Christmas Day (6). Holidays: New Year's Day, Memorial Day, Independence Day, Thanksgiving Day, Friday after Thanksgiving Day, Christmas Eve Day, And Christmas Day (7). K. Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday After Thanksgiving Day, The Day Before Christmas, And Christmas Day (9). L. Holidays: New Year's Day, Martin Luther King Jr. Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, And Christmas Day (8). N. Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Veterans' Day, Thanksgiving Day, The Friday After Thanksgiving Day, And Christmas Day (9). P. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday And Saturday After Thanksgiving Day, The Day Before Christmas, And Christmas Day (9). If A Holiday Falls On Sunday, The Following Monday Shall Be Considered As A Holiday. Q. Paid Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, and Christmas Day (6). R. Paid Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Day After Thanksgiving Day, One -Half Day Before Christmas Day, And Christmas Day. (7 1/2). S. Paid Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, And Christmas Day (7). Z. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Veterans Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (8). 6. G. Paid Holidays: New Year's Day, Martin Luther King Jr. Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Veterans' Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Day, and Christmas Eve Day (11). H. Paid Holidays: New Year's Day, New Year's Eve Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday After Thanksgiving Day, Christmas Day, The Day After Christmas, And A Floating Holiday (10). 7of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Holiday Codes Continued T. Paid Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, The Friday After Thanksgiving Day, The Last Working Day Before Christmas Day, And Christmas Day (9). Z. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, And Christmas Day (7). If a holiday falls on Saturday, the preceding Friday shall be considered as the holiday. If a holiday falls on Sunday, the following Monday shall be considered as the holiday. A. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday and Saturday after Thanksgiving Day, And Christmas Day (8). Any Holiday Which Falls On A Sunday Shall Be Observed As A Holiday On The Following Monday. If any of the listed holidays falls on a Saturday, the preceding Friday shall be a regular work day. B. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday and Saturday after Thanksgiving Day, And Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. C. Holidays: New Year's Day, Martin Luther King Jr. Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. D. Paid Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Veteran's Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (8). Unpaid Holidays: President's Day. Any paid holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any paid holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. E. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. F. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, the last working day before Christmas day and Christmas day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. G. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, and Christmas Day (6). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. H. Holidays: New Year's Day, Martin Luther King Jr. Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, the Last Working Day before Christmas Day and Christmas Day (9). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. I. Holidays: New Year's Day, President's Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day, The Friday After Thanksgiving Day, The Day Before Christmas Day And Christmas Day (9). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. 8of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Holiday Codes Continued Holidays: New Year's Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day and Christmas Day (6). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. K. Holidays: New Year's Day, Memorial Day, Independence Day, Thanksgiving Day, the Friday and Saturday after Thanksgiving Day, And Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. L. Holidays: New Year's Day, Memorial Day, Labor Day, Independence Day, Thanksgiving Day, the Last Work Day before Christmas Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. N. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. When Christmas falls on a Saturday, the preceding Friday shall be observed as a holiday. P. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Q. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, the Last Working Day before Christmas Day and Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. If any of the listed holidays falls on a Saturday, the preceding Friday shall be a regular work day. S. Paid Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, Christmas Day, the Day after Christmas, and A Floating Holiday (9). If any of the listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. V. Holidays: New Year's Day, President's Birthday, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Day, the day before or after Christmas, and the day before or after New Year's Day. If any of the above listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. W. Holidays: New Year's Day, Day After New Year's, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Eve Day, Christmas Day, the day after Christmas, the day before New Year's Day, and a Floating Holiday. X. Holidays: New Year's Day, Day before or after New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Day, and the day before or after Christmas day. If a holiday falls on a Saturday or on a Friday that is the normal day off, then the holiday will be taken on the last normal workday. If the holiday falls on a Monday that is the normal day off or on a Sunday, then the holiday will be taken on the next normal workday. Y. Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, and Christmas Day. (8) If the holiday falls on a Sunday, then the day observed by the federal government shall be considered a holiday and compensated accordingly. 9of14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Holiday Codes Continued G. New Year's Day, Washington's Birthday, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, The Friday After Thanksgiving Day, the last scheduled workday before Christmas, and Christmas Day (9). If any of the listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. H. Holidays: New Year's Day, Martin Luther King Jr. Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, the Last Working Day before Christmas Day and Christmas Day (9). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. I. Holidays: New Year's Day, President's Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day, The Friday After Thanksgiving Day, The Day Before Christmas Day And Christmas Day (9). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. Holidays: New Year's Day, Independence Day, Memorial Day, Labor Day, Thanksgiving Day and Christmas Day (6). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. K. Holidays: New Year's Day, Memorial Day, Independence Day, Thanksgiving Day, the Friday and Saturday after Thanksgiving Day, And Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. L. Holidays: New Year's Day, Memorial Day, Labor Day, Independence Day, Thanksgiving Day, the Last Work Day before Christmas Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Any holiday which falls on a Saturday shall be observed as a holiday on the preceding Friday. N. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. When Christmas falls on a Saturday, the preceding Friday shall be observed as a holiday. P. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, And Christmas Day (7). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. Q. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, the Last Working Day before Christmas Day and Christmas Day (8). Any holiday which falls on a Sunday shall be observed as a holiday on the following Monday. If any of the listed holidays falls on a Saturday, the preceding Friday shall be a regular work day. S. Paid Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, Christmas Day, the Day after Christmas, and A Floating Holiday (9). If any of the listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. V. Holidays: New Year's Day, President's Birthday, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Day, the day before or after Christmas, and the day before or after New Year's Day. If any of the above listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. 10 of 14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Holiday Codes Continued 7. W. Holidays: New Year's Day, Day After New Year's, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Eve Day, Christmas Day, the day after Christmas, the day before New Year's Day, and a Floating Holiday. X. Holidays: New Year's Day, Day before or after New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, Christmas Day, and the day before or after Christmas day. If a holiday falls on a Saturday or on a Friday that is the normal day off, then the holiday will be taken on the last normal workday. If the holiday falls on a Monday that is the normal day off or on a Sunday, then the holiday will be taken on the next normal workday. Y. Holidays: New Year's Day, Presidents' Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, the Friday after Thanksgiving Day, and Christmas Day. (8) If the holiday falls on a Sunday, then the day observed by the federal government shall be considered a holiday and compensated accordingly. 15. F. Holidays: New Year's Day, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Friday after Thanksgiving Day, the last scheduled workday before Christmas, and Christmas Day (8). If any of the listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. G. New Year's Day, Washington's Birthday, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, The Friday After Thanksgiving Day, the last scheduled workday before Christmas, and Christmas Day (9). If any of the listed holidays falls on a Sunday, the day observed by the Nation shall be considered a holiday and compensated accordingly. Note Codes 8. D. Workers working with supplied air on hazmat projects receive an additional $1.00 per hour. L. Workers on hazmat projects receive additional hourly premiums as follows -Level A: $0.75, Level B: $0.50, And Level C: $0.25. M. Workers on hazmat projects receive additional hourly premiums as follows: Levels A & B: $1.00, Levels C & D: $0.50. N. Workers on hazmat projects receive additional hourly premiums as follows -Level A: $1.00, Level B: $0.75, Level C: $0.50, And Level D: $0.25. S. Effective August 31, 2012 —A Traffic Control Supervisor shall be present on the project whenever flagging or spotting or other traffic control labor is being utilized. Flaggers and Spotters shall be posted where shown on approved Traffic Control Plans or where directed by the Engineer. All flaggers and spotters shall possess a current flagging card issued by the State of Washington, Oregon, Montana, or Idaho. This classification is only effective on or after August 31, 2012. 11 of 14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Note Codes Continued 8. T. Effective August 31, 2012 — A Traffic Control Laborer performs the setup, maintenance and removal of all temporary traffic control devices and construction signs necessary to control vehicular, bicycle, and pedestrian traffic during construction operations. Flaggers and Spotters shall be posted where shown on approved Traffic Control Plans or where directed by the Engineer. All flaggers and spotters shall possess a current flagging card issued by the State of Washington, Oregon, Montana, or Idaho. This classification is only effective on or after August 31, 2012. U. Workers on hazmat projects receive additional hourly premiums as follows — Class A Suit: $2.00, Class B Suit: $1.50, And Class C Suit: $1.00. Workers performing underground work receive an additional $0.40 per hour for any and all work performed underground, including operating, servicing and repairing of equipment. The premium for underground work shall be paid for the entire shift worked. Workers who work suspended by a rope or cable receive an additional $0.50 per hour. The premium for work suspended shall be paid for the entire shift worked. Workers who do "pioneer" work (break open a cut, build road, etc.) more than one hundred fifty (150) feet above grade elevation receive an additional $0.50 per hour. V. In addition to the hourly wage and fringe benefits, the following depth and enclosure premiums shall be paid. The premiums are to be calculated for the maximum depth and distance into an enclosure that a diver reaches in a day. The premiums are to be paid one time for the day and are not used in calculating overtime pay. Depth premiums apply to depths of fifty feet or more. Over 50' to 100' - $2.00 per foot for each foot over 50 feet. Over 10l' to 150' - $3.00 per foot for each foot over 101 feet. Over 15l' to 220' - $4.00 per foot for each foot over 220 feet. Over 22 F - $5.00 per foot for each foot over 221 feet. Enclosure premiums apply when divers enter enclosures (such as pipes or tunnels) where there is no vertical ascent and is measured by the distance travelled from the entrance. 25' to 300' - $1.00 per foot from entrance. 300' to 600' - $1.50 per foot beginning at 300'. Over 600' - $2.00 per foot beginning at 600'. W. Meter Installers work on single phase 120/240V self-contained residential meters. The Lineman/Groundmen rates would apply to meters not fitting this description. X. Workers on hazmat projects receive additional hourly premiums as follows - Class A Suit: $2.00, Class B Suit: $1.50, Class C Suit: $1.00, and Class D Suit: $0.50. Special Shift Premium: Basic hourly rate plus $2.00 per hour. When due to conditions beyond the control of the Employer or when an owner (not acting as the contractor), a government agency or the contract specifications requires that work can only be performed outside the normal 5 am to 6pm shift, then the special shift premium will be applied to the basic hourly rate. When an employee works on a special shift, they shall be paid a special shift premium for each hour worked unless they are in OT or Double-time status. (For example, the special shift premium does not waive the overtime requirements for work performed on Saturday or Sunday.) Y. Tide Work: When employees are called out between the hours of 6:00 p.m. and 6:00 a.m. to work on tide work (work located in the tide plane) all time worked shall be at one and one-half times the hourly rate of pay. Swinging Stage/Boatswains Chair: Employees working on a swinging state or boatswains chair or under conditions that require them to be tied off to allow their hands to be free shall receive seventy-five cents ($0.75) per hour above the classification rate. 12 of 14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Note Codes Continued 8. Z. Workers working with supplied air on hazmat projects receive an additional $1.00 per hour. Special Shift Premium: Basic hourly rate plus $2.00 per hour. When due to conditions beyond the control of the Employer or when an owner (not acting as a contractor), a government agency or the contract specifications require that more than (4) hours of a special shift can only be performed outside the normal 6 am to 6pm shift, then the special shift premium will be applied to the basic straight time for the entire shift. When an employee works on a special shift, they will be paid a special shift premium for each hour worked unless they are in overtime or double- time status. (For example, the special shift premium does not waive the overtime requirements for work performed on Saturday or Sunday.) A. Workers working with supplied air on hazmat projects receive an additional $1.00 per hour. Special Shift Premium: Basic hourly rate plus $2.00 per hour. When due to conditions beyond the control of the Employer or when an owner (not acting as the contractor), a government agency or the contract specifications require that more than four (4) hours of a special shift can only be performed outside the normal 6 am to 6pm shift, then the special shift premium will be applied to the basic straight time for the entire shift. When an employee works on a special shift, they shall be paid a special shift premium for each hour worked unless they are in overtime or double- time status. (For example, the special shift premium does not waive the overtime requirements for work performed on Saturday or Sunday.) Certified Crane Operator Premium: Crane operators requiring certifications shall be paid $0.50 per hour above their classification rate. Boom Pay Premium: All cranes including tower shall be paid as follows based on boom length: (A) — 130' to 199' — $0.50 per hour over their classification rate. (B) — 200' to 299' — $0.80 per hour over their classification rate. (C) — 300' and over — $1.00 per hour over their classification rate. B. The highest pressure registered on the gauge for an accumulated time of more than fifteen (15) minutes during the shift shall be used in determining the scale paid. Tide Work: When employees are called out between the hours of 6:00 p.m. and 6:00 a.m. to work on tide work (work located in the tide plane) all time worked shall be at one and one-half times the hourly rate of pay. Swinging Stage/Boatswains Chair: Employees working on a swinging stage or boatswains chair or under conditions that require them to be tied off to allow their hands to be free shall receive seventy-five cents ($0.75) per hour above the classification rate. C. Tide Work: When employees are called out between the hours of 6:00 p.m. and 6:00 a.m. to work on tide work (work located in the tide plane) all time worked shall be at one and one-half times the hourly rate of pay. Swinging Stage/Boatswains Chair: Employees working on a swinging stage or boatswains chair or under conditions that require them to be tied off to allow their hands to be free shall receive seventy-five cents ($0.75) per hour above the classification rate. Effective August 31, 2012 — A Traffic Control Supervisor shall be present on the project whenever flagging or spotting or other traffic control labor is being utilized. A Traffic Control Laborer performs the setup, maintenance and removal of all temporary traffic control devices and construction signs necessary to control vehicular, bicycle, and pedestrian traffic during construction operations. Flaggers and Spotters shall be posted where shown on approved Traffic Control Plans or where directed by the Engineer. All flaggers and spotters shall possess a current flagging card issued by the State of Washington, Oregon, Montana, or Idaho. These classifications are only effective on or after August 31, 2012. 13 of 14 Benefit Code Key — Effective 3/3/2021 thru 8/31/2021 Note Codes Continued D. Industrial Painter wages are required for painting within industrial facilities such as treatment plants, pipelines, towers, dams, bridges, power generation facilities and manufacturing facilities such as chemical plants, etc., or anywhere abrasive blasting is necessary to prepare surfaces, or hazardous materials encapsulation is required. E. Heavy Construction includes construction, repair, alteration or additions to the production, fabrication or manufacturing portions of industrial or manufacturing plants, hydroelectric or nuclear power plants and atomic reactor construction. Workers on hazmat projects receive additional hourly premiums as follows -Level A: $1.00, Level B: $0.75, Level C: $0.50, And Level D: $0.25. F. Industrial Painter wages are required for painting within industrial facilities such as treatment plants, pipelines, towers, dams, power generation facilities and manufacturing facilities such as chemical plants, etc., or anywhere abrasive blasting is necessary to prepare surfaces, or hazardous materials encapsulation is required. 14 of 14                           Page | 1 "General Decision Number: WA20210001 02/12/2021 Superseded General Decision Number: WA20200001 State: Washington Construction Type: Highway Counties: Washington Statewide. HIGHWAY (Excludes D.O.E. Hanford Site in Benton and Franklin Counties) Note: Under Executive Order (EO) 13658, an hourly minimum wage of $10.95 for calendar year 2021 applies to all contracts subject to the Davis-Bacon Act for which the contract is awarded (and any solicitation was issued) on or after January 1, 2015. If this contract is covered by the EO, the contractor must pay all workers in any classification listed on this wage determination at least $10.95 per hour (or the applicable wage rate listed on this wage determination, if it is higher) for all hours spent performing on the contract in calendar year 2021. If this contract is covered by the EO and a classification considered necessary for performance of work on the contract does not appear on this wage determination, the contractor must pay workers in that classification at least the wage rate determined through the conformance process set forth in 29 CFR 5.5(a)(1)(ii) (or the EO minimum wage rate,if it is higher than the conformed wage rate). The EO minimum wage rate will be adjusted annually. Please note that this EO applies to the above-mentioned types of contracts entered into by the federal government that are subject to the Davis-Bacon Act itself, but it does not apply to contracts subject only to the Davis-Bacon Related Acts, including those set forth at 29 CFR 5.1(a)(2)-(60). Additional information on contractor requirements and worker protections under the EO is available at www.dol.gov/whd/govcontracts. Modification Number Publication Date 0 01/01/2021 1 01/22/2021 2 02/12/2021 1 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 2 CARP0003-006 06/01/2018 SOUTHWEST WASHINGTON: CLARK, COWLITZ, KLICKITAT, LEWIS(Piledriver only), PACIFIC (South of a straight line made by extending the north boundary line of Wahkiakum County west to Willapa Bay to the Pacific Ocean), SKAMANIA, and WAHKIAKUM Counties. Rates Fringes Carpenters: CARPENTERS..................$ 37.64 16.83 DIVERS TENDERS..............$ 43.73 16.83 DIVERS......................$ 87.73 16.83 DRYWALL.....................$ 37.64 16.83 MILLWRIGHTS.................$ 38.17 16.83 PILEDRIVERS.................$ 38.71 16.83 DEPTH PAY: 50 TO 100 FEET $1.00 PER FOOT OVER 50 FEET 101 TO 150 FEET $1.50 PER FOOT OVER 101 FEET 151 TO 200 FEET $2.00 PER FOOT OVER 151 FEET Zone Differential (Add up Zone 1 rates): Zone 2 - $0.85 Zone 3 -1.25 Zone 4 -1.70 Zone 5 -2.00 Zone 6 -3.00 BASEPOINTS: ASTORIA, LONGVIEW, PORTLAND, THE DALLES, AND VANCOUVER, (NOTE: All dispatches for Washington State Counties: Cowlitz, Wahkiakum and Pacific shall be from Longview Local #1707 and mileage shall be computed from that point.) ZONE 1: Projects located within 30 miles of the respective city hall of the above mentioned cities ZONE 2: Projects located more than 30 miles and less than 40 miles of the respective city of the above mentioned cities ZONE 3: Projects located more than 40 miles and less than 50 miles of the respective city of the above mentioned cities ZONE 4: Projects located more than 50 miles and less than 60 miles of the respective city of the above mentioned cities. ZONE 5: Projects located more than 60 miles and less than 70 miles of the respective city of the above mentioned cities ZONE 6: Projects located more than 70 miles of the respected city of the above mentioned cities 2 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 3 CARP0030-004 06/01/2020 CLALLAM, GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, LEWIS, MASON, PACIFIC (North of a straight line made by extending the north boundary line of Wahkiakum County west to the Pacific Ocean), PIERCE, SAN JUAN, SKAGIT, SNOHOMISH, THURSTON AND WHATCOM Counties Rates Fringes CARPENTER BRIDGE CARPENTERS...........$ 46.92 18.02 CARPENTERS ON CREOSOTE MATERIAL....................$ 47.02 18.02 CARPENTERS..................$ 46.92 18.02 DIVERS TENDER...............$ 51.89 18.02 DIVERS......................$ 100.78 18.02 MILLWRIGHT AND MACHINE ERECTORS....................$ 48.42 18.02 PILEDRIVER, DRIVING, PULLING, CUTTING, PLACING COLLARS, SETTING, WELDING OR CRESOTE TREATED MATERIAL, ALL PILING........$ 47.17 18.02 (HOURLY ZONE PAY: WESTERN AND CENTRAL WASHINGTON - ALL CLASSIFICATIONS EXCEPT MILLWRIGHTS AND PILEDRIVERS Hourly Zone Pay shall be paid on jobs located outside of the free zone computed from the city center of the following listed cities: Seattle Auburn Olympia Bremerton Bellingham Anacortes Renton Shelton Yakima Aberdeen-Hoquiam Ellensburg Centralia Chelan Tacoma Everett Mount Vernon Pt. Townsend Wenatchee Port Angeles Sunnyside Zone Pay: 0 -25 radius miles Free 26-35 radius miles $1.00/hour 36-45 radius miles $1.15/hour 46-55 radius miles $1.35/hour Over 55 radius miles $1.55/hour (HOURLY ZONE PAY: WESTERN AND CENTRAL WASHINGTON - MILLWRIGHT AND PILEDRIVER ONLY) Hourly Zone Pay shall be computed from Seattle Union Hall, Tacoma City center, and Everett City center Zone Pay: 0 -25 radius miles Free 26-45 radius miles $ .70/hour Over 45 radius miles $1.50/hour 3 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 4 CARP0059-002 06/01/2019 ADAMS, ASOTIN, BENTON, CHELAN (East of 120th meridian), COLUMBIA, DOUGLAS, FERRY, FRANKLIN, GARFIELD, GRANT (East of 120th meridian), KITTITAS (East of 120th meridian), LINCOLN, OKANOGAN (East of 120th meridian), PEND OREILLE, SPOKANE, STEVENS, WALLA WALLA, WHITMAN, and YAKIMA (East of 120th meridian) Counties Rates Fringes CARPENTER GROUP 1.....................$ 35.47 16.88 GROUP 2.....................$ 47.42 18.96 GROUP 3.....................$ 36.66 16.88 GROUP 4.....................$ 36.66 16.88 GROUP 5.....................$ 83.96 16.88 GROUP 6.....................$ 40.23 16.88 GROUP 7.....................$ 41.23 16.88 GROUP 8.....................$ 37.66 16.88 GROUP 9.....................$ 44.23 16.88 CARPENTER & DIVER CLASSIFICATIONS: GROUP 1: Carpenter GROUP 2: Millwright, Machine Erector GROUP 3: Piledriver - includes driving, pulling, cutting, placing collars, setting, welding, or creosote treated material, on all piling GROUP 4: Bridge, Dock, and Wharf carpenters GROUP 5: Diver Wet GROUP 6: Diver Tender, Manifold Operator, ROV Operator GROUP 7: Diver Standby GROUP 8: Assistant Diver Tender, ROV Tender/Technician GROUP 9: Manifold Operator-Mixed Gas ZONE PAY: ZONE 1 0-45 MILES FREE ZONE 2 45-100 $4.00/PER HOUR ZONE 3 OVER 100 MILES $6.00/PER HOUR 4 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 5 DISPATCH POINTS: CARPENTERS/MILLWRIGHTS: PASCO (515 N Neel Street) or Main Post Office of established residence of employee (Whichever is closest to the worksite). CARPENTERS/PILEDRIVER: SPOKANE (127 E. AUGUSTA AVE.) or Main Post Office of established residence of employee (Whichever is closest to the worksite). CARPENTERS: WENATCHEE (27 N. CHELAN) or Main Post Office of established residence of employee (Whichever is closest to the worksite). CARPENTERS: COEUR D' ALENE (1839 N. GOVERNMENT WAY) or Main Post Office of established residence of employee (Whichever is closest to the worksite). CARPENTERS: MOSCOW (306 N. JACKSON) or Main Post Office of established residence of employee (Whichever is closest to the worksite). DEPTH PAY FOR DIVERS BELOW WATER SURFACE: 50-100 feet $2.00 per foot 101-150 feet $3.00 per foot 151-220 feet $4.00 per foot 221 feet and deeper $5.00 per foot PREMIUM PAY FOR DIVING IN ENCLOSURES WITH NO VERTICAL ASCENT: 0-25 feet Free 26-300 feet $1.00 per Foot SATURATION DIVING: The standby rate applies until saturation starts. The saturation diving rate applies when divers are under pressure continuously until work task and decompression are complete. the diver rate shall be paid for all saturation hours. WORK IN COMBINATION OF CLASSIFICATIONS: Employees working in any combination of classifications within the diving crew (except dive supervisor) in a shift are paid in the classification with the highest rate for that shift. HAZMAT PROJECTS: Anyone working on a HAZMAT job (task), where HAZMAT certification is required, shall be compensated at a premium, in addition to the classification working in as follows: LEVEL D + $.25 per hour - This is the lowest level of protection. No respirator is used and skin protection is minimal. 5 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 6 LEVEL C + $.50 per hour - This level uses an air purifying respirator or additional protective clothing. LEVEL B + $.75 per hour - Uses same respirator protection as Level A. Supplied air line is provided in conjunction with a chemical ""splash suit"". LEVEL A +$1.00 per hour - This level utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line. CARP0770-003 06/01/2020 WEST OF 120TH MERIDIAN FOR THE FOLLOWING COUNTIES: CHELAN, DOUGLAS, GRANT, KITTITAS, OKANOGAN, and YAKIMA Rates Fringes CARPENTER CARPENTERS ON CREOSOTE MATERIAL....................$ 47.02 18.02 CARPENTERS..................$ 46.92 18.02 DIVERS TENDER...............$ 51.89 18.02 DIVERS......................$ 100.78 18.02 MILLWRIGHT AND MACHINE ERECTORS....................$ 48.42 18.02 PILEDRIVER, DRIVING, PULLING, CUTTING, PLACING COLLARS, SETTING, WELDING OR CRESOTE TREATED MATERIAL, ALL PILING........$ 47.17 18.02 (HOURLY ZONE PAY: WESTERN AND CENTRAL WASHINGTON - ALL CLASSIFICATIONS EXCEPT MILLWRIGHTS AND PILEDRIVERS Hourly Zone Pay shall be paid on jobs located outside of the free zone computed from the city center of the following listed cities: Seattle Olympia Bellingham Auburn Bremerton Anacortes Renton Shelton Yakima Aberdeen-Hoquiam Tacoma Wenatchee Ellensburg Everett Port Angeles Centralia Mount Vernon Sunnyside Chelan Pt. Townsend Zone Pay: 0 -25 radius miles Free 26-35 radius miles $1.00/hour 36-45 radius miles $1.15/hour 46-55 radius miles $1.35/hour Over 55 radius miles $1.55/hour 6 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 7 (HOURLY ZONE PAY: WESTERN AND CENTRAL WASHINGTON - MILLWRIGHT AND PILEDRIVER ONLY) Hourly Zone Pay shall be computed from Seattle Union Hall, Tacoma City center, and Everett City center Zone Pay: 0 -25 radius miles Free 26-45 radius miles $ .70/hour Over 45 radius miles $1.50/hour ELEC0046-001 08/03/2020 CALLAM, JEFFERSON, KING AND KITSAP COUNTIES Rates Fringes CABLE SPLICER....................$ 59.91 3%+21.46 ELECTRICIAN......................$ 58.78 3%+22.51 * ELEC0048-003 01/01/2021 CLARK, KLICKITAT AND SKAMANIA COUNTIES Rates Fringes CABLE SPLICER....................$ 44.22 21.50 ELECTRICIAN......................$ 50.35 25.48 HOURLY ZONE PAY: Hourly Zone Pay shall be paid on jobs located outside of the free zone computed from the city center of the following listed cities: Portland, The Dalles, Hood River, Tillamook, Seaside and Astoria Zone Pay: Zone 1: 31-50 miles $1.50/hour Zone 2: 51-70 miles $3.50/hour Zone 3: 71-90 miles $5.50/hour Zone 4: Beyond 90 miles $9.00/hour *These are not miles driven. Zones are based on Delorrne Street Atlas USA 2006 plus. * ELEC0048-029 01/01/2021 COWLITZ AND WAHKIAKUM COUNTY Rates Fringes CABLE SPLICER....................$ 44.22 21.50 ELECTRICIAN......................$ 50.35 25.48 7 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 8 ELEC0073-001 07/01/2020 ADAMS, FERRY, LINCOLN, PEND OREILLE, SPOKANE, STEVENS, WHITMAN COUNTIES Rates Fringes CABLE SPLICER....................$ 34.10 16.68 ELECTRICIAN......................$ 37.65 19.68 ELEC0076-002 08/31/2020 GRAYS HARBOR, LEWIS, MASON, PACIFIC, PIERCE, AND THURSTON COUNTIES Rates Fringes CABLE SPLICER....................$ 53.15 23.81 ELECTRICIAN......................$ 48.32 23.67 ELEC0112-005 06/01/2020 ASOTIN, BENTON, COLUMBIA, FRANKLIN, GARFIELD, KITTITAS, WALLA WALLA, YAKIMA COUNTIES Rates Fringes CABLE SPLICER....................$ 50.45 22.27 ELECTRICIAN......................$ 48.05 22.12 ELEC0191-003 06/01/2020 ISLAND, SAN JUAN, SNOHOMISH, SKAGIT AND WHATCOM COUNTIES Rates Fringes CABLE SPLICER....................$ 44.23 17.73 ELECTRICIAN......................$ 47.95 26.16 ELEC0191-004 06/01/2018 CHELAN, DOUGLAS, GRANT AND OKANOGAN COUNTIES Rates Fringes CABLE SPLICER....................$ 40.82 17.63 ELECTRICIAN......................$ 42.45 21.34 8 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 9 ENGI0302-003 06/01/2020 CHELAN (WEST OF THE 120TH MERIDIAN), CLALLAM, DOUGLAS (WEST OF THE 120TH MERIDIAN), GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, KITTITAS, MASON, OKANOGAN (WEST OF THE 120TH MERIDIAN), SAN JUNA, SKAGIT, SNOHOMISH, WHATCOM AND YAKIMA (WEST OF THE 120TH MERIDIAN) COUNTIES Zone 1 (0-25 radius miles): Rates Fringes POWER EQUIPMENT OPERATOR Group 1A...................$ 48.41 Group 1AA..................$ 49.13 Group 1AAA.................$ 49.83 Group 1.....................$ 47.70 Group 2.....................$ 47.08 Group 3.....................$ 46.55 Group 4.....................$ 43.54 22.47 22.47 22.47 22.47 22.47 22.47 22.47 Zone Differential (Add to Zone 1 rates): Zone 2 (26-45 radius miles) - $1.00 Zone 3 (Over 45 radius miles) - $1.30 BASEPOINTS: Aberdeen, Bellingham, Bremerton, Everett, Kent, Mount Vernon, Port Angeles, Port Townsend, Seattle, Shelton, Wenatchee, Yakima POWER EQUIPMENT OPERATORS CLASSIFICATIONS GROUP 1AAA - Cranes-over 300 tons, or 300 ft of boom (including jib with attachments) GROUP 1AA - Cranes 200 to 300 tons, or 250 ft of boom (including jib with attachments); Tower crane over 175 ft in height, base to boom GROUP 1A - Cranes, 100 tons thru 199 tons, or 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 100 tons and over; Tower crane up to 175 ft in height base to boom; Loaders-overhead, 8 yards and over; Shovels, excavator, backhoes-6 yards and over with attachments 9 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 10 GROUP 1 - Cableway; Cranes 45 tons thru 99 tons, under 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 45 tons thru 99 tons; Derricks on building work; Excavator, shovel, backhoes over 3 yards and under 6 yards; Hard tail end dump articulating off-road equipment 45 yards and over; Loader- overhead 6 yards to, but not including 8 yards; Mucking machine, mole, tunnel, drill and/or shield; Quad 9, HD 41, D-10; Remote control operator on rubber tired earth moving equipment; Rollagon; Scrapers-self propelled 45 yards and over; Slipform pavers; Transporters, all truck or track type GROUP 2 - Barrier machine (zipper); Batch Plant Operaor- Concrete; Bump Cutter; Cranes, 20 tons thru 44 tons with attachments; Crane-overhead, bridge type-20 tons through 44 tons; Chipper; Concrete Pump-truck mount with boom attachment; Crusher; Deck Engineer/Deck Winches (power); Drilling machine; Excavator, shovel, backhoe-3yards and under; Finishing Machine, Bidwell, Gamaco and similar equipment; Guardrail punch; Horizontal/directional drill operator; Loaders-overhead under 6 yards; Loaders-plant feed; Locomotives-all; Mechanics-all; Mixers-asphalt plant; Motor patrol graders-finishing; Piledriver (other than crane mount); Roto-mill,roto-grinder; Screedman, spreader, topside operator-Blaw Knox, Cedar Rapids, Jaeger, Caterpillar, Barbar Green; Scraper-self propelled, hard tail end dump, articulating off-road equipment-under 45 yards; Subgrade trimmer; Tractors, backhoes-over 75 hp; Transfer material service machine-shuttle buggy, blaw knox-roadtec; Truck crane oiler/driver-100 tons and over; Truck Mount portable conveyor; Yo Yo Pay dozer GROUP 3 - Conveyors; Cranes-thru 19 tons with attachments; A-frame crane over 10 tons; Drill oilers-auger type, truck or crane mount; Dozers-D-9 and under; Forklift-3000 lbs. and over with attachments; Horizontal/directional drill locator; Outside hoists-(elevators and manlifts), air tuggers, strato tower bucket elevators; Hydralifts/boom trucks over 10 tons; Loader-elevating type, belt; Motor patrol grader-nonfinishing; Plant oiler- asphalt, crusher; Pumps-concrete; Roller, plant mix or multi-lift materials; Saws-concrete; Scrpers-concrete and carry-all; Service engineer-equipment; Trenching machines; Truck Crane Oiler/Driver under 100 tons; Tractors, backhoe 75 hp and under GROUP 4 - Assistant Engineer; Bobcat; Brooms; Compressor; Concrete finish mahine-laser screed; Cranes-A frame-10 tons and under; Elevator and Manlift-permanent or shaft type; Gradechecker, Stakehop; Forklifts under 3000 lbs. with attachments; Hydralifts/boom trucks, 10 tons and under; Oil distributors, blower distribution and mulch seeding operator; Pavement breaker; Posthole digger, mechanical; Power plant; Pumps, water; Rigger and Bellman; Roller-other than plant mix; Wheel Tractors, farmall type; Shotcrete/gunite equipment operator 10 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 11 HANDLING OF HAZARDOUS WASTE MATERIALS: Personnel in all craft classifications subject to working inside a federally designated hazardous perimeter shall be elgible for compensation in accordance with the following group schedule relative to the level of hazardous waste as outlined in the specific hazardous waste project site safety plan. H-1 Base wage rate when on a hazardous waste site when not outfitted with protective clothing H-2 Class ""C"" Suit - Base wage rate plus $ .25 per hour. H-3 Class ""B"" Suit - Base wage rate plus $ .50 per hour. H-4 Class ""A"" Suit - Base wage rate plus $ .75 per hour. ENGI0370-002 07/01/2019 ADAMS, ASOTIN, BENTON, CHELAN (EAST OF THE 120TH MERIDIAN), COLUMBIA, DOUGLAS (EAST OF THE 120TH MERIDIAN), FERRY, FRANKLIN, GARFIELD, GRANT, LINCOLN, OKANOGAN (EAST OF THE 120TH MERIDIAN), PEND OREILLE, SPOKANE, STEVENS, WALLA WALLA, WHITMAN AND YAKIMA (EAST OF THE 120TH MERIDIAN) COUNTIES ZONE 1: Rates Fringes POWER EQUIPMENT OPERATOR GROUP 1.....................$ 28.46 17.25 GROUP 2.....................$ 28.78 17.25 GROUP 3.....................$ 29.39 17.25 GROUP 4.....................$ 29.55 17.25 GROUP 5.....................$ 29.71 17.25 GROUP 6.....................$ 29.99 17.25 GROUP 7.....................$ 30.26 17.25 GROUP 8.....................$ 31.36 17.25 ZONE DIFFERENTIAL (Add to Zone 1 rate): Zone 2 - $2.00 Zone 1: Within 45 mile radius of Spokane, Pasco, Washington; Lewiston, Idaho Zone 2: Outside 45 mile radius of Spokane, Pasco, Washington; Lewiston, Idaho 11 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 12 POWER EQUIPMENT OPERATORS CLASSIFICATIONS GROUP 1: Bit Grinders; Bolt Threading Machine; Compressors (under 2000 CFM, gas, diesel, or electric power); Deck Hand; Fireman & Heater Tender; Hydro-seeder, Mulcher, Nozzleman; Oiler Driver, & Cable Tender, Mucking Machine; Pumpman; Rollers, all types on subgrade, including seal and chip coatings (farm type, Case, John Deere & similar, or Compacting Vibrator), except when pulled by Dozer with operable blade; Welding Machine; Crane Oiler-Driver (CLD required) & Cable Tender, Mucking Machine GROUP 2: A-frame Truck (single drum); Assistant Refrigeration Plant (under 1000 ton); Assistant Plant Operator, Fireman or Pugmixer (asphalt); Bagley or Stationary Scraper; Belt Finishing Machine; Blower Operator (cement); Cement Hog; Compressor (2000 CFM or over, 2 or more, gas diesel or electric power); Concrete Saw (multiple cut); Distributor Leverman; Ditch Witch or similar; Elevator Hoisting Materials; Dope Pots (power agitated); Fork Lift or Lumber Stacker, hydra-lift & similar; Gin Trucks (pipeline); Hoist, single drum; Loaders (bucket elevators and conveyors); Longitudinal Float; Mixer (portable-concrete); Pavement Breaker, Hydra-Hammer & similar; Power Broom; Railroad Ballast Regulation Operator (self-propelled); Railroad Power Tamper Operator (self-propelled); Railroad Tamper Jack Operator (self-propelled; Spray Curing Machine (concrete); Spreader Box (self-propelled); Straddle Buggy (Ross & similar on construction job only); Tractor (Farm type R/T with attachment, except Backhoe); Tugger Operator GROUP 3: A-frame Truck (2 or more drums); Assistant Refrigeration Plant & Chiller Operator (over 1000 ton); Backfillers (Cleveland & similar); Batch Plant & Wet Mix Operator, single unit (concrete); Belt-Crete Conveyors with power pack or similar; Belt Loader (Kocal or similar); Bending Machine; Bob Cat (Skid Steer); Boring Machine (earth); Boring Machine (rock under 8 inch bit) (Quarry Master, Joy or similar); Bump Cutter (Wayne, Saginau or similar); Canal Lining Machine (concrete); Chipper (without crane); Cleaning & Doping Machine (pipeline); Deck Engineer; Elevating Belt-type Loader (Euclid, Barber Green & similar); Elevating Grader-type Loader (Dumor, Adams or similar); Generator Plant Engineers (diesel or electric); Gunnite Combination Mixer & Compressor; Locomotive Engineer; Mixermobile; Mucking Machine; Posthole Auger or Punch; Pump (grout or jet); Soil Stabilizer (P & H or similar); Spreader Machine; Dozer/Tractor (up to D-6 or equivalent) and Traxcavator; Traverse Finish Machine; Turnhead Operator 12 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 13 GROUP 4: Concrete Pumps (squeeze-crete, flow-crete, pump- crete, Whitman & similar); Curb Extruder (asphalt or concrete); Drills (churn, core, calyx or diamond); Equipment Serviceman; Greaser & Oiler; Hoist (2 or more drums or Tower Hoist); Loaders (overhead & front-end, under 4 yds. R/T); Refrigeration Plant Engineer (under 1000 ton); Rubber-tired Skidders (R/T with or without attachments); Surface Heater & Plant Machine; Trenching Machines (under 7 ft. depth capacity); Turnhead (with re-screening); Vacuum Drill (reverse circulation drill under 8 inch bit) GROUP 5: Backhoe (under 45,000 gw); Backhoe & Hoe Ram (under 3/4 yd.); Carrydeck & Boom Truck (under 25 tons); Cranes (25 tons & under), all attachments including clamshell, dragline; Derricks & Stifflegs (under 65 tons); Drilling Equipment(8 inch bit & over) (Robbins, reverse circulation & similar); Hoe Ram; Piledriving Engineers; Paving (dual drum); Railroad Track Liner Operaotr (self-propelled); Refrigeration Plant Engineer (1000 tons & over); Signalman (Whirleys, Highline Hammerheads or similar); Grade Checker GROUP 6: Asphalt Plant Operator; Automatic Subgrader (Ditches & Trimmers)(Autograde, ABC, R.A. Hansen & similar on grade wire); Backhoe (45,000 gw and over to 110,000 gw); Backhoes & Hoe Ram (3/4 yd. to 3 yd.); Batch Plant (over 4 units); Batch & Wet Mix Operator (multiple units, 2 & incl. 4); Blade Operator (motor patrol & attachments); Cable Controller (dispatcher); Compactor (self-propelled with blade); Concrete Pump Boom Truck; Concrete Slip Form Paver; Cranes (over 25 tons, to and including 45 tons), all attachments including clamshell, dragline; Crusher, Grizzle & Screening Plant Operator; Dozer, 834 R/T & similar; Drill Doctor; Loader Operator (front-end & overhead, 4 yds. incl. 8 yds.); Multiple Dozer Units with single blade; Paving Machine (asphalt and concrete); Quad-Track or similar equipment; Rollerman (finishing asphalt pavement); Roto Mill (pavement grinder); Scrapers, all, rubber-tired; Screed Operator; Shovel(under 3 yds.); Trenching Machines (7 ft. depth & over); Tug Boat Operator Vactor guzzler, super sucker; Lime Batch Tank Operator (REcycle Train); Lime Brain Operator (Recycle Train); Mobile Crusher Operator (Recycle Train) 13 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 14 GROUP 7: Backhoe (over 110,000 gw); Backhoes & Hoe Ram (3 yds & over); Blade (finish & bluetop) Automatic, CMI, ABC, Finish Athey & Huber & similar when used as automatic; Cableway Operators; Concrete Cleaning/Decontamination machine operator; Cranes (over 45 tons to but not including 85 tons), all attachments including clamshell and dragine; Derricks & Stiffleys (65 tons & over); Elevating Belt (Holland type); Heavy equipment robotics operator; Loader (360 degrees revolving Koehring Scooper or similar); Loaders (overhead & front-end, over 8 yds. to 10 yds.); Rubber-tired Scrapers (multiple engine with three or more scrapers); Shovels (3 yds. & over); Whirleys & Hammerheads, ALL; H.D. Mechanic; H.D. Welder; Hydraulic Platform Trailers (Goldhofer, Shaurerly andSimilar); Ultra High Pressure Wateriet Cutting Tool System Operator (30,000 psi); Vacuum Blasting Machine Operator GROUP 8: Cranes (85 tons and over, and all climbing, overhead,rail and tower), all attachments including clamshell, dragline; Loaders (overhead and front-end, 10 yards and over); Helicopter Pilot BOOM PAY: (All Cranes, Including Tower) 180 ft to 250 ft $ .50 over scale Over 250 ft $ .80 over scale NOTE: In computing the length of the boom on Tower Cranes, they shall be measured from the base of the Tower to the point of the boom. HAZMAT: Anyone working on HAZMAT jobs, working with supplied air shall receive $1.00 an hour above classification. ENGI0612-001 06/01/2020 PIERCE County ON PROJECTS DESCRIBED IN FOOTNOTE A BELOW, THE RATE FOR EACH GROUP SHALL BE 90% OF THE BASE RATE PLUS FULL FRINGE BENEFITS. ON ALL OTHER WORK, THE FOLLOWING RATES APPLY. Zone 1 (0-25 radius miles): Rates Fringes POWER EQUIPMENT OPERATOR GROUP 1A...................$ 49.50 22.47 GROUP 1AA..................$ 50.22 22.47 GROUP 1AAA.................$ 50.94 22.47 GROUP 1.....................$ 48.77 22.47 GROUP 2.....................$ 48.15 22.47 GROUP 3.....................$ 47.60 22.47 GROUP 4.....................$ 44.55 22.47 14 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 15 Zone Differential (Add to Zone 1 rates): Zone 2 (26-45 radius miles) = $1.00 Zone 3 (Over 45 radius miles) - $1.30 BASEPOINTS: CENTRALIA, OLYMPIA, TACOMA POWER EQUIPMENT OPERATORS CLASSIFICATIONS GROUP 1 AAA - Cranes-over 300 tons or 300 ft of boom (including jib with attachments) GROUP 1AA - Cranes- 200 tonsto 300 tons, or 250 ft of boom (including jib with attachments; Tower crane over 175 ft in height, bas to boom GROUP 1A - Cranes, 100 tons thru 199 tons, or 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 100 tons and over; Tower crane up to 175 ft in height base to boom; Loaders-overhead, 8 yards and over; Shovels, excavator, backhoes-6 yards and over with attachments GROUP 1 - Cableway; Cranes 45 tons thru 99 tons under 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 45 tons thru 99 tons; Derricks on building work; Excavator, shovel, backhoes over 3 yards and under 6 yards; Hard tail end dump articulating off-road equipment 45 yards and over; Loader- overhead, 6 yards to, but not including, 8 yards; Mucking machine, mole, tunnel, drill and/or shield; Quad 9 HD 41, D-10; Remote control operator on rubber tired earth moving equipment; Rollagon; Scrapers- self-propelled 45 yards and over; Slipform pavers; Transporters, all track or truck type GROUP 2 - Barrier machine (zipper); Batch Plant Operator- concrete; Bump Cutter; Cranes, 20 tons thru 44 tons with attachments; Crane-Overhead, bridge type, 20 tons through 44 tons; Chipper; Concrete pump-truck mount with boom attachment; Crusher; Deck engineer/deck winches (power); Drilling machine; Excavator, shovel, backhoe-3 yards and under; Finishing machine, Bidwell, Gamaco and similar equipment; Guardrail punch; Loaders, overhead under 6 yards; Loaders-plant feed; Locomotives-all; Mechanics- all; Mixers, asphalt plant; Motor patrol graders, finishing; Piledriver (other than crane mount); Roto-mill, roto- grinder; Screedman, spreader, topside operator-Blaw Knox, Cedar Rapids, Jaeger, Caterpillar, Barbar Green; Scraper-self- propelled, hard tail end dump, articulating off-road equipment- under 45 yards; Subgrader trimmer; Tractors, backhoe over 75 hp; Transfer material service machine-shuttle buggy, Blaw Knox- Roadtec; Truck Crane oiler/driver-100 tons and over; Truck Mount Portable Conveyor; Yo Yo pay 15 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 16 GROUP 3 - Conveyors; Cranes through 19 tons with attachments; Crane-A-frame over 10 tons; Drill oilers-auger type, truck or crane mount; Dozer-D-9 and under; Forklift-3000 lbs. and over with attachments; Horizontal/directional drill locator; Outside Hoists-(elevators and manlifts), air tuggers, strato tower bucket elevators; Hydralifts/boom trucks over 10 tons; Loaders-elevating type, belt; Motor patrol grader-nonfinishing; Plant oiler- asphalt, crusher; Pump-Concrete; Roller, plant mix or multi-lfit materials; Saws-concrete; Scrapers, concrete and carry all; Service engineers-equipment; Trenching machines; Truck crane oiler/driver under 100 tons; Tractors, backhoe under 75 hp GROUP 4 - Assistant Engineer; Bobcat; Brooms; Compressor; Concrete Finish Machine-laser screed; Cranes A-frame 10 tons and under; Elevator and manlift (permanent and shaft type); Forklifts-under 3000 lbs. with attachments; Gradechecker, stakehop; Hydralifts/boom trucks, 10 tons and under; Oil distributors, blower distribution and mulch seeding operator; Pavement breaker; Posthole digger-mechanical; Power plant; Pumps-water; Rigger and Bellman; Roller-other than plant mix; Wheel Tractors, farmall type; Shotcrete/gunite equipment operator FOOTNOTE A- Reduced rates may be paid on the following: 1. Projects involving work on structures such as buildings and bridges whose total value is less than $1.5 million excluding mechanical, electrical, and utility portions of the contract. 2. Projects of less than $1 million where no building is involved. Surfacing and paving included, but utilities excluded. 3. Marine projects (docks, wharfs, etc.) less than $150,000. HANDLING OF HAZARDOUS WASTE MATERIALS: Personnel in all craft classifications subject to working inside a federally designated hazardous perimeter shall be elgible for compensation in accordance with the following group schedule relative to the level of hazardous waste as outlined in the specific hazardous waste project site safety plan. H-1 Base wage rate when on a hazardous waste site when not outfitted with protective clothing, Class ""D"" Suit - Base wage rate plus $ .50 per hour. H-2 Class ""C"" Suit - Base wage rate plus $1.00 per hour. H-3 Class ""B"" Suit - Base wage rate plus $1.50 per hour. H-4 Class ""A"" Suit - Base wage rate plus $2.00 per hour. 16 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 17 ENGI0612-012 06/01/2020 LEWIS, PACIFIC (portion lying north of a parallel line extending west from the northern boundary of Wahkaikum County to the sea) AND THURSTON COUNTIES ON PROJECTS DESCRIBED IN FOOTNOTE A BELOW, THE RATE FOR EACH GROUP SHALL BE 90% OF THE BASE RATE PLUS FULL FRINGE BENEFITS. ON ALL OTHER WORK, THE FOLLOWING RATES APPLY. Zone 1 (0-25 radius miles): Rates Fringes POWER EQUIPMENT OPERATOR GROUP 1A...................$ 48.41 22.47 GROUP 1AA..................$ 49.13 22.47 GROUP 1AAA.................$ 49.83 22.47 GROUP 1.....................$ 47.70 22.47 GROUP 2.....................$ 47.08 22.47 GROUP 3.....................$ 46.55 22.47 GROUP 4.....................$ 43.54 22.47 Zone Differential (Add to Zone 1 rates): Zone 2 (26-45 radius miles) = $1.00 Zone 3 (Over 45 radius miles) - $1.30 BASEPOINTS: CENTRALIA, OLYMPIA, TACOMA POWER EQUIPMENT OPERATORS CLASSIFICATIONS GROUP 1 AAA - Cranes-over 300 tons or 300 ft of boom (including jib with attachments) GROUP 1AA - Cranes- 200 tonsto 300 tons, or 250 ft of boom (including jib with attachments; Tower crane over 175 ft in height, bas to boom GROUP 1A - Cranes, 100 tons thru 199 tons, or 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 100 tons and over; Tower crane up to 175 ft in height base to boom; Loaders-overhead, 8 yards and over; Shovels, excavator, backhoes-6 yards and over with attachments GROUP 1 - Cableway; Cranes 45 tons thru 99 tons under 150 ft of boom (including jib with attachments); Crane-overhead, bridge type, 45 tons thru 99 tons; Derricks on building work; Excavator, shovel, backhoes over 3 yards and under 6 yards; Hard tail end dump articulating off-road equipment 45 yards and over; Loader- overhead, 6 yards to, but not including, 8 yards; Mucking machine, mole, tunnel, drill and/or shield; Quad 9 HD 41, D-10; Remote control operator on rubber tired earth moving equipment; Rollagon; Scrapers- self-propelled 45 yards and over; Slipform pavers; Transporters, all track or truck type 17 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 18 GROUP 2 - Barrier machine (zipper); Batch Plant Operator- concrete; Bump Cutter; Cranes, 20 tons thru 44 tons with attachments; Crane-Overhead, bridge type, 20 tons through 44 tons; Chipper; Concrete pump-truck mount with boom attachment; Crusher; Deck engineer/deck winches (power); Drilling machine; Excavator, shovel, backhoe-3 yards and under; Finishing machine, Bidwell, Gamaco and similar equipment; Guardrail punch; Loaders, overhead under 6 yards; Loaders-plant feed; Locomotives-all; Mechanics- all; Mixers, asphalt plant; Motor patrol graders, finishing; Piledriver (other than crane mount); Roto-mill, roto- grinder; Screedman, spreader, topside operator-Blaw Knox, Cedar Rapids, Jaeger, Caterpillar, Barbar Green; Scraper-self- propelled, hard tail end dump, articulating off-road equipment- under 45 yards; Subgrader trimmer; Tractors, backhoe over 75 hp; Transfer material service machine-shuttle buggy, Blaw Knox- Roadtec; Truck Crane oiler/driver-100 tons and over; Truck Mount Portable Conveyor; Yo Yo pay GROUP 3 - Conveyors; Cranes through 19 tons with attachments; Crane-A-frame over 10 tons; Drill oilers-auger type, truck or crane mount; Dozer-D-9 and under; Forklift-3000 lbs. and over with attachments; Horizontal/directional drill locator; Outside Hoists-(elevators and manlifts), air tuggers, strato tower bucket elevators; Hydralifts/boom trucks over 10 tons; Loaders-elevating type, belt; Motor patrol grader-nonfinishing; Plant oiler- asphalt, crusher; Pump-Concrete; Roller, plant mix or multi-lfit materials; Saws-concrete; Scrapers, concrete and carry all; Service engineers-equipment; Trenching machines; Truck crane oiler/driver under 100 tons; Tractors, backhoe under 75 hp GROUP 4 - Assistant Engineer; Bobcat; Brooms; Compressor; Concrete Finish Machine-laser screed; Cranes A-frame 10 tons and under; Elevator and manlift (permanent and shaft type); Forklifts-under 3000 lbs. with attachments; Gradechecker, stakehop; Hydralifts/boom trucks, 10 tons and under; Oil distributors, blower distribution and mulch seeding operator; Pavement breaker; Posthole digger-mechanical; Power plant; Pumps-water; Rigger and Bellman; Roller-other than plant mix; Wheel Tractors, farmall type; Shotcrete/gunite equipment operator FOOTNOTE A- Reduced rates may be paid on the following: 1. Projects involving work on structures such as buildings and bridges whose total value is less than $1.5 million excluding mechanical, electrical, and utility portions of the contract. 2. Projects of less than $1 million where no building is involved. Surfacing and paving included, but utilities excluded. 3. Marine projects (docks, wharfs, etc.) less than $150,000. 18 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 19 HANDLING OF HAZARDOUS WASTE MATERIALS: Personnel in all craft classifications subject to working inside a federally designated hazardous perimeter shall be elgible for compensation in accordance with the following group schedule relative to the level of hazardous waste as outlined in the specific hazardous waste project site safety plan. H-1 Base wage rate when on a hazardous waste site when not outfitted with protective clothing, Class ""D"" Suit - Base wage rate plus $ .50 per hour. H-2 Class ""C"" Suit - Base wage rate plus $1.00 per hour. H-3 Class ""B"" Suit - Base wage rate plus $1.50 per hour. H-4 Class ""A"" Suit - Base wage rate plus $2.00 per hour. ENGI0701-002 01/01/2018 CLARK, COWLITZ, KLICKKITAT, PACIFIC (SOUTH), SKAMANIA, AND WAHKIAKUM COUNTIES POWER RQUIPMENT OPERATORS: ZONE 1 Rates Fringes POWER EQUIPMENT OPERATOR GROUP 1.....................$ 41.65 14.35 GROUP 1A....................$ 43.73 14.35 GROUP 1B....................$ 45.82 14.35 GROUP 2.....................$ 39.74 14.35 GROUP 3.....................$ 38.59 14.35 GROUP 4.....................$ 37.51 14.35 GROUP 5.....................$ 36.27 14.35 GROUP 6.....................$ 33.05 14.35 Zone Differential (add to Zone 1 rates): Zone 2 - $3.00 Zone 3 - $6.00 For the following metropolitan counties: MULTNOMAH; CLACKAMAS; MARION; WASHINGTON; YAMHILL; AND COLUMBIA; CLARK; AND COWLITZ COUNTY, WASHINGTON WITH MODIFICATIONS AS INDICATED: All jobs or projects located in Multnomah, Clackamas and Marion Counties, West of the western boundary of Mt. Hood National Forest and West of Mile Post 30 on Interstate 84 and West of Mile Post 30 on State Highway 26 and West of Mile Post 30 on Highway 22 and all jobs or projects located in Yamhill County, Washington County and Columbia County and all jobs or porjects located in Clark & Cowlitz County, Washington except that portion of Cowlitz County in the Mt. St. Helens ""Blast Zone"" shall receive Zone I pay for all classifications. 19 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 20 All jobs or projects located in the area outside the identified boundary above, but less than 50 miles from the Portland City Hall shall receive Zone II pay for all classifications. All jobs or projects located more than 50 miles from the Portland City Hall, but outside the identified border above, shall receive Zone III pay for all classifications. For the following cities: ALBANY; BEND; COOS BAY; EUGENE; GRANTS PASS; KLAMATH FALLS; MEDFORD; ROSEBURG All jobs or projects located within 30 miles of the respective city hall of the above mentioned cities shall receive Zone I pay for all classifications. All jobs or projects located more than 30 miles and less than 50 miles from the respective city hall of the above mentioned cities shall receive Zone II pay for all classifications. All jobs or projects located more than 50 miles from the respective city hall of the above mentioned cities shall receive Zone III pay for all classifications. POWER EQUIPMENT OPERATORS CLASSIFICATIONS Group 1 Concrete Batch Plan and or Wet mix three (3) units or more; Crane, Floating one hundred and fifty (150) ton but less than two hundred and fifty (250) ton; Crane, two hundred (200) ton through two hundred ninety nine (299) ton with two hundred foot (200') boom or less (including jib, inserts and/or attachments); Crane, ninety (90) ton through one hundred ninety nine (199) ton with over two hundred (200') boom Including jib, inserts and/or attachments); Crane, Tower Crane with one hundred seventy five foot (175') tower or less and with less than two hundred foot (200') jib; Crane, Whirley ninety (90) ton and over; Helicopter when used in erecting work Group 1A Crane, floating two hundred fifty (250) ton and over; Crane, two hundred (200) ton through two hundred ninety nine (299) ton, with over two hundred foot (200') boom (including jib, inserts and/or attachments); Crane, three hundred (300) ton through three hundred ninety nine (399) ton; Crane, Tower Crane with over one hundred seventy five foot (175') tower or over two hundred foot (200') jib; Crane, tower Crane on rail system or 2nd tower or more in work radius 20 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 21 Group 1B Crane, three hundred (300) ton through three hundred ninety nine (399) ton, with over two hundred foot (200') boom (including jib, inserts and/or attachments); Floating crane, three hundred fifty (350) ton and over; Crane, four hundred (400) ton and over Group 2 Asphalt Plant (any type); Asphalt Roto-Mill, pavement profiler eight foot (8') lateral cut and over; Auto Grader or ""Trimmer""; Blade, Robotic; Bulldozer, Robotic Equipment (any type); Bulldozer, over one hundred twenty thousand (120,000) lbs. and above; Concrete Batch Plant and/or Wet Mix one (1) and two (2) drum; Concrete Diamond Head Profiler; Canal Trimmer; Concrete, Automatic Slip Form Paver (Assistant to the Operator required); Crane, Boom Truck fifty (50) ton and with over one hundred fifty foot (150') boom and over; Crane, Floating (derrick barge) thirty (30) ton but less than one hundred fifty (150) ton; Crane, Cableway twenty-five (25) ton and over; Crane, Floating Clamshell three (3) cu. Yds. And over; Crane, ninety (90) ton through one hundred ninety nine (199) ton up to and including two hundred foot (200') of boom (including jib inserts and/or attachments); Crane, fifty (50) ton through eighty nine (89) ton with over one hundred fifty foot (150') boom (including jib inserts and/or attachments); Crane, Whirley under ninety (90) ton; Crusher Plant; Excavator over one hundred thirty thousand (130,000) lbs.; Loader one hundred twenty thousand (120,000) lbs. and above; Remote Controlled Earth Moving Equipment; Shovel, Dragline, Clamshell, five (5) cu. Yds. And over; Underwater Equipment remote or otherwise, when used in construction work; Wheel Excavator any size Group 3 Bulldozer, over seventy thousand (70,000) lbs. up to and including one hundred twenty thousand (120,000) lbs.; Crane, Boom Truck fifty (50) ton and over with less than one hundred fifty foot (150') boom; Crane, fifty (50) ton through eighty nine (89) ton with one hundred fifty foot (150') boom or less (including jib inserts and/or attachments); Crane, Shovel, Dragline or Clamshell three (3) cu. yds. but less than five (5) cu. Yds.; Excavator over eighty thousand (80,000) lbs. through one hundred thirty thousand (130,000) lbs.; Loader sixty thousand (60,000) lbs. and less than one hundred twenty thousand (120,000) lbs. 21 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 22 Group 4 Asphalt, Screed; Asphalt Paver; Asphalt Roto-Mill, pavement profiler, under eight foot (8') lateral cut; Asphalt, Material Transfer Vehicle Operator; Back Filling Machine; Backhoe, Robotic, track and wheel type up to and including twenty thousand (20,000) lbs. with any attachments; Blade (any type); Boatman; Boring Machine; Bulldozer over twenty thousand (20,000) lbs. and more than one hundred (100) horse up to seventy thousand (70,000) lbs.; Cable-Plow (any type); Cableway up to twenty five (25) ton; Cat Drill (John Henry); Chippers; Compactor, multi-engine; Compactor, Robotic; Compactor with blade self-propelled; Concrete, Breaker; Concrete, Grout Plant; Concrete, Mixer Mobile; Concrete, Paving Road Mixer; Concrete, Reinforced Tank Banding Machine; Crane, Boom Truck twenty (20) ton and under fifty (50) ton; Crane, Bridge Locomotive, Gantry and Overhead; Crane, Carry Deck; Crane, Chicago Boom and similar types; Crane, Derrick Operator, under one hundred (100) ton; Crane, Floating Clamshell, Dragline, etc. Operator, under three (3) cu. yds. Or less than thirty (30) ton; Crane, under fifty (50) ton; Crane, Quick Tower under one hundred foot (100') in height and less than one hundred fifty foot (150') jib (on rail included); Diesel-Electric Engineer (Plant or Floating); Directional Drill over twenty thousand (20,000) lbs. pullback; Drill Cat Operator; Drill Doctor and/or Bit Grinder; Driller, Percussion, Diamond, Core, Cable, Rotary and similar type; Excavator Operator over twenty thousand (20,000) lbs. through eighty thousand (80,000) lbs.; Generator Operator; Grade-all; Guardrail Machines, i.e. punch, auger, etc.; Hammer Operator (Piledriver); Hoist, stiff leg, guy derrick or similar type, fifty (50) ton and over; Hoist, two (2) drums or more; Hydro Axe (loader mounted or similar type); Jack Operator, Elevating Barges, Barge Operator, self-unloading; Loader Operator, front end and overhead, twenty five thousand (25,000) lbs. and less than sixty thousand (60,000) lbs.; Log Skidders; Piledriver Operator (not crane type); Pipe, Bending, Cleaning, Doping and Wrapping Machines; Rail, Ballast Tamper Multi-Purpose; Rubber-tired Dozers and Pushers; Scraper, all types; Side-Boom; Skip Loader, Drag Box; Strump Grinder (loader mounted or similar type); Surface Heater and Planer; Tractor, rubber-tired, over fifty (50) HP Flywheel; Trenching Machine three foot (3') depth and deeper; Tub Grinder (used for wood debris); Tunnel Boring Machine Mechanic; Tunnel, Mucking Machine; Ultra High Pressure Water Jet Cutting Tool System Operator; Vacuum Blasting Machine Operator; Water pulls, Water wagons 22 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 23 Group 5 Asphalt, Extrusion Machine; Asphalt, Roller (any asphalt mix); Asphalt, Roto-Mill pavement profiler ground man; Bulldozer, twenty thousand (20,000) lbs. or less, or one hundred (100) horse or less; Cement Pump; Chip Spreading Machine; Churn Drill and Earth Boring Machine; Compactor, self-propelled without blade; Compressor, (any power) one thousand two hundred fifty (1,250) cu. ft. and over, total capacity; Concrete, Batch Plant Quality control; Concrete, Combination Mixer and compressor operator, gunite work; Concrete, Curb Machine, Mechanical Berm, Curb and/or Curb and Gutter; Concrete, Finishing Machine; Concrete, Grouting Machine; Concrete, Internal Full Slab Vibrator Operator; Concrete, Joint Machine; Concrete, Mixer single drum, any capacity; Concrete, Paving Machine eight foot (8') or less; Concrete, Planer; Concrete, Pump; Concrete, Pump Truck; Concrete, Pumpcrete Operator (any type); Concrete, Slip Form Pumps, power driven hydraulic lifting device for concrete forms; Conveyored Material Hauler; Crane, Boom Truck under twenty (20) tons; Crane, Boom Type lifting device, five (5) ton capacity or less; Drill, Directional type less than twenty thousand (20,000) lbs. pullback; Fork Lift, over ten (10) ton or Robotic; Helicopter Hoist; Hoist Operator, single drum; Hydraulic Backhoe track type up to and including twenty thousand (20,000) lbs.; Hydraulic Backhoe wheel type (any make); Laser Screed; Loaders, rubber-tired type, less than twenty five thousand (25,000) lbs.; Pavement Grinder and/or Grooving Machine (riding type); Pipe, cast in place Pipe Laying Machine; Pulva-Mixer or similar types; Pump Operator, more than five (5) pumps (any size); Rail, Ballast Compactor, Regulator, or Tamper machines; Service Oiler (Greaser); Sweeper Self-Propelled; Tractor, Rubber-Tired, fifty (50) HP flywheel and under; Trenching Machine Operator, maximum digging capacity three foot (3') depth; Tunnel, Locomotive, Dinkey; Tunnel, Power Jumbo setting slip forms, etc. Group 6 Asphalt, Pugmill (any type); Asphalt, Raker; Asphalt, Truck Mounted Asphalt Spreader, with Screed; Auger Oiler; Boatman; Bobcat, skid steed (less than one (1) yard); Broom, self-propelled; Compressor Operator (any power) under 1,250 cu. ft. total capacity; Concrete Curing Machine (riding type); Concrete Saw; Conveyor Operator or Assistant; Crane, Tugger; Crusher Feederman; Crusher Oiler; Deckhand; Drill, Directional Locator; Fork Lift; Grade Checker; Guardrail Punch Oiler; Hydrographic Seeder Machine, straw, pulp or seed; Hydrostatic Pump Operator; Mixer Box (CTB, dry batch, etc.); Oiler; Plant Oiler; Pump (any power); Rail, Brakeman, Switchman, Motorman; Rail, Tamping Machine, mechanical, self-propelled; Rigger; Roller grading (not asphalt); Truck, Crane Oiler-Driver 23 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 24 IRON0014-005 07/01/2020 ADAMS, ASOTIN, BENTON, COLUMBIA, DOUGLAS, FERRY, FRANKLIN, GARFIELD, GRANT, LINCOLN, OKANOGAN, PEND ORIELLE, SPOKANE, STEVENS, WALLA WALLA AND WHITMAN COUNTIES Rates Fringes IRONWORKER.......................$ 34.59 30.10 IRON0029-002 07/01/2020 CLARK, COWLITZ, KLICKITAT, PACIFIC, SKAMANIA, AND WAHKAIKUM COUNTIES Rates Fringes IRONWORKER.......................$ 39.10 29.75 IRON0086-002 07/01/2020 YAKIMA, KITTITAS AND CHELAN COUNTIES Rates Fringes IRONWORKER.......................$ 34.59 30.10 IRON0086-004 07/01/2020 CLALLAM, GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, LEWIS, MASON, PIERCE, SKAGIT, SNOHOMISH, THURSTON, AND WHATCOM COUNTIES Rates Fringes IRONWORKER.......................$ 43.95 31.00 24 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 25 LABO0238-004 06/01/2020 PASCO AREA: ADAMS, BENTON, COLUMBIA,DOUGLAS (East of 120th Meridian), FERRY, FRANKLIN, GRANT, OKANOGAN, WALLA WALLA SPOKANE AREA: ASOTIN, GARFIELD, LINCOLN, PEND OREILLE, SPOKANE, STEVENS & WHITMAN COUNTIES Rates Fringes LABORER (PASCO) GROUP 1.....................$ 26.69 13.65 GROUP 2.....................$ 28.79 13.65 GROUP 3.....................$ 29.06 13.65 GROUP 4.....................$ 29.33 13.65 GROUP 5.....................$ 29.61 13.65 LABORER (SPOKANE) GROUP 1.....................$ 26.69 13.65 GROUP 2.....................$ 28.79 13.65 GROUP 3.....................$ 29.06 13.65 GROUP 4.....................$ 29.33 13.65 GROUP 5.....................$ 29.61 13.65 Zone Differential (Add to Zone 1 rate): $2.00 BASE POINTS: Spokane, Pasco, Lewiston Zone 1: 0-45 radius miles from the main post office. Zone 2: 45 radius miles and over from the main post office. LABORERS CLASSIFICATIONS GROUP 1: Flagman; Landscape Laborer; Scaleman; Traffic Control Maintenance Laborer (to include erection and maintenance of barricades, signs and relief of flagperson); Window Washer/Cleaner (detail cleanup, such as, but not limited to cleaning floors, ceilings, walls, windows, etc. prior to final acceptance by the owner) GROUP 2: Asbestos Abatement Worker; Brush Hog Feeder; Carpenter Tender; Cement Handler; Clean-up Laborer; Concrete Crewman (to include stripping of forms, hand operating jacks on slip form construction, application of concrete curing compounds, pumpcrete machine, signaling, handling the nozzle of squeezcrete or similar machine,6 inches and smaller); Confined Space Attendant; Concrete Signalman; Crusher Feeder; Demolition (to include clean-up, burning, loading, wrecking and salvage of all material); Dumpman; Fence Erector; Firewatch; Form Cleaning Machine Feeder, Stacker; General Laborer; Grout Machine Header Tender; Guard Rail (to include guard rails, guide and reference posts, sign posts, and right-of-way markers); Hazardous Waste Worker, Level D (no respirator is used and skin protection is minimal); Miner, Class ""A"" (to include 25 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 26 all bull gang, concrete crewman, dumpman and pumpcrete crewman, including distributing pipe, assembly & dismantle, and nipper); Nipper; Riprap Man; Sandblast Tailhoseman; Scaffold Erector (wood or steel); Stake Jumper; Structural Mover (to include separating foundation, preparation, cribbing, shoring, jacking and unloading of structures); Tailhoseman (water nozzle); Timber Bucker and Faller (by hand); Track Laborer (RR); Truck Loader; Well-Point Man; All Other Work Classifications Not Specially Listed Shall Be Classified As General Laborer GROUP 3: Asphalt Roller, walking; Cement Finisher Tender; Concrete Saw, walking; Demolition Torch; Dope Pot Firemen, non-mechanical; Driller Tender (when required to move and position machine); Form Setter, Paving; Grade Checker using level; Hazardous Waste Worker, Level C (uses a chemical ""splash suit"" and air purifying respirator); Jackhammer Operator; Miner, Class ""B"" (to include brakeman, finisher, vibrator, form setter); Nozzleman (to include squeeze and flo-crete nozzle); Nozzleman, water, air or steam; Pavement Breaker (under 90 lbs.); Pipelayer, corrugated metal culvert; Pipelayer, multi- plate; Pot Tender; Power Buggy Operator; Power Tool Operator, gas, electric, pneumatic; Railroad Equipment, power driven, except dual mobile power spiker or puller; Railroad Power Spiker or Puller, dual mobile; Rodder and Spreader; Tamper (to include operation of Barco, Essex and similar tampers); Trencher, Shawnee; Tugger Operator; Wagon Drills; Water Pipe Liner; Wheelbarrow (power driven) GROUP 4: Air and Hydraulic Track Drill; Aspahlt Raker;Brush Machine (to include horizontal construction joint cleanup brush machine, power propelled); Caisson Worker, free air; Chain Saw Operator and Faller; Concrete Stack (to include laborers when laborers working on free standing concrete stacks for smoke or fume control above 40 feet high); Gunite (to include operation of machine and nozzle); Hazardous Waste Worker, Level B (uses same respirator protection as Level A. A supplied air line is provided in conjunction with a chemical ""splash suit""); High Scaler; Laser Beam Operator (to include grade checker and elevation control); Miner, Class C (to include miner, nozzleman for concrete, laser beam operator and rigger on tunnels); Monitor Operator (air track or similar mounting); Mortar Mixer; Nozzleman (to include jet blasting nozzleman, over 1,200 lbs., jet blast machine power propelled, sandblast nozzle); Pavement Breaker (90 lbs. and over); Pipelayer (to include working topman, caulker, collarman, jointer, mortarman, rigger, jacker, shorer, valve or meter installer); Pipewrapper; Plasterer Tender; Vibrators (all) GROUP 5 - Drills with Dual Masts; Hazardous Waste Worker, Level A (utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line); Miner Class ""D"", (to include raise and shaft miner, laser beam operator on riases and shafts) 26 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 27 LABO0238-006 06/01/2019 COUNTIES EAST OF THE 120TH MERIDIAN: ADAMS, ASOTIN, BENTON, CHELAN, COLUMBIA, DOUGLAS, FERRY, FRANKLIN, GARFIELD, GRANT, LINCOLN, OKANOGAN, PEND OREILLE, STEVENS, SPOKANE, WALLA WALLA, WHITMAN Rates Fringes Hod Carrier......................$ 27.95 12.90 LABO0242-003 06/01/2020 KING COUNTY Rates Fringes LABORER GROUP 1.....................$ 27.78 12.35 GROUP 2A....................$ 31.82 12.35 GROUP 3.....................$ 39.81 12.35 GROUP 4.....................$ 40.77 12.35 GROUP 5.....................$ 41.43 12.35 Group 6.....................$ 41.43 12.35 BASE POINTS: BELLINGHAM, MT. VERNON, EVERETT, SEATTLE, KENT, TACOMA, OLYMPIA, CENTRALIA, ABERDEEN, SHELTON, PT. TOWNSEND, PT. ANGELES, AND BREMERTON ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 but less than 45 radius miles from the respective city hall ZONE 3 - More than 45 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $1.00 ZONE 3 - $1.30 BASE POINTS: CHELAN, SUNNYSIDE, WENATCHEE, AND YAKIMA ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $2.25 27 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 28 LABORERS CLASSIFICATIONS GROUP 1: Landscaping and Planting; Watchman; Window Washer/Cleaner (detail clean-up, such as but not limited to cleaning floors, ceilings, walls, windows, etc., prior to final acceptance by the owner) GROUP 2A: Batch Weighman; Crusher Feeder; Fence Laborer; Flagman; Pilot Car GROUP 3: General Laborer; Air, Gas, or Electric Vibrating Screed; Asbestos Abatement Laborer; Ballast Regulator Machine; Brush Cutter; Brush Hog Feeder; Burner; Carpenter Tender; Cement Finisher Tender; Change House or Dry Shack; Chipping Gun (under 30 lbs.); Choker Setter; Chuck Tender; Clean-up Laborer; Concrete Form Stripper; Curing Laborer; Demolition (wrecking and moving including charred material); Ditch Digger; Dump Person; Fine Graders; Firewatch; Form Setter; Gabian Basket Builders; Grout Machine Tender; Grinders; Guardrail Erector; Hazardous Waste Worker (Level C: uses a chemical ""splash suit"" and air purifying respirator); Maintenance Person; Material Yard Person; Pot Tender; Rip Rap Person; Riggers; Scale Person; Sloper Sprayer; Signal Person; Stock Piler; Stake Hopper; Toolroom Man (at job site); Topper-Tailer; Track Laborer; Truck Spotter; Vinyl Seamer GROUP 4: Cement Dumper-Paving; Chipping Gun (over 30 lbs.); Clary Power Spreader; Concrete Dumper/Chute Operator; Concrete Saw Operator; Drill Operator (hydraulic, diamond, aiartrac); Faller and Bucker Chain Saw; Grade Checker and Transit Person; Groutmen (pressure) including post tension beams; Hazardous Waste Worker (Level B: uses same respirator protection as Level A. A supplied air line is provided in conjunction with a chemical ""splash suit""); High Scaler; Jackhammer; Laserbeam Operator; Manhole Builder-Mudman; Nozzleman (concrete pump, green cutter when using combination of high pressure air and water on concrete and rock, sandblast, gunite, shotcrete, water blaster, vacuum blaster); Pavement Breaker; Pipe Layer and Caulker; Pipe Pot Tender; Pipe Reliner (not insert type); Pipe Wrapper; Power Jacks; Railroad Spike Puller-Power; Raker-Asphalt; Rivet Buster; Rodder; Sloper (over 20 ft); Spreader (concrete); Tamper and Similar electric, air and glas operated tool; Timber Person-sewer (lagger shorer and cribber); Track Liner Power; Tugger Operator; Vibrator; Well Point Laborer GROUP 5: Caisson Worker; Mortarman and Hodcarrier; Powderman; Re-Timberman; Hazardous Waste Worker (Level A: utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line). Group 6: Miner 28 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 29 LABO0252-010 06/01/2020 CLALLAM, GRAYS HARBOR, JEFFERSON, KITSAP, LEWIS, MASON, PACIFIC (EXCLUDING SOUTHWEST), PIERCE, AND THURSTON COUNTIES Rates Fringes LABORER GROUP 1.....................$ 27.78 12.44 GROUP 2.....................$ 31.82 12.44 GROUP 3.....................$ 39.81 12.44 GROUP 4.....................$ 40.77 12.44 GROUP 5.....................$ 41.43 12.44 BASE POINTS: BELLINGHAM, MT. VERNON, EVERETT, SEATTLE, KENT, TACOMA, OLYMPIA, CENTRALIA, ABERDEEN, SHELTON, PT. TOWNSEND, PT. ANGELES, AND BREMERTON ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 but less than 45 radius miles from the respective city hall ZONE 3 - More than 45 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $1.00 ZONE 3 - $1.30 BASE POINTS: CHELAN, SUNNYSIDE, WENATCHEE, AND YAKIMA ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $2.25 LABORERS CLASSIFICATIONS GROUP 1: Landscaping and Planting; Watchman; Window Washer/Cleaner (detail clean-up, such as but not limited to cleaning floors, ceilings, walls, windows, etc., prior to final acceptance by the owner) GROUP 2: Batch Weighman; Crusher Feeder; Fence Laborer; Flagman; Pilot Car 29 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 30 GROUP 3: General Laborer; Air, Gas, or Electric Vibrating Screed; Asbestos Abatement Laborer; Ballast Regulator Machine; Brush Cutter; Brush Hog Feeder; Burner; Carpenter Tender; Cement Finisher Tender; Change House or Dry Shack; Chipping Gun (under 30 lbs.); Choker Setter; Chuck Tender; Clean-up Laborer; Concrete Form Stripper; Curing Laborer; Demolition (wrecking and moving including charred material); Ditch Digger; Dump Person; Fine Graders; Firewatch; Form Setter; Gabian Basket Builders; Grout Machine Tender; Grinders; Guardrail Erector; Hazardous Waste Worker (Level C: uses a chemical ""splash suit"" and air purifying respirator); Maintenance Person; Material Yard Person; Pot Tender; Rip Rap Person; Riggers; Scale Person; Sloper Sprayer; Signal Person; Stock Piler; Stake Hopper; Toolroom Man (at job site); Topper-Tailer; Track Laborer; Truck Spotter; Vinyl Seamer GROUP 4: Cement Dumper-Paving; Chipping Gun (over 30 lbs.); Clary Power Spreader; Concrete Dumper/Chute Operator; Concrete Saw Operator; Drill Operator (hydraulic, diamond, aiartrac); Faller and Bucker Chain Saw; Groutmen (pressure) including post tension beams; Hazardous Waste Worker (Level B: uses same respirator protection as Level A. A supplied air line is provided in conjunction with a chemical ""splash suit""); Jackhammer; Laserbeam Operator; Manhole Builder-Mudman; Nozzleman (concrete pump, green cutter when using combination of high pressure air and water on concrete and rock, sandblast, gunite, shotcrete, water blaster, vacuum blaster); Pavement Breaker; Pipe Layer and Caulker; Pipe Pot Tender; Pipe Reliner (not insert type); Pipe Wrapper; Power Jacks; Railroad Spike Puller-Power; Raker-Asphalt; Rivet Buster; Rodder; Sloper (over 20 ft); Spreader (concrete); Tamper and Similar electric, air and glas operated tool; Timber Person-sewer (lagger shorer and cribber); Track Liner Power; Tugger Operator; Vibrator; Well Point Laborer GROUP 5: Caisson Worker; Miner; Mortarman and Hodcarrier; Grade Checker and Transit Person; High Scaler; Powderman; Re-Timberman; Hazardous Waste Worker (Level A: utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line). 30 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 31 LABO0292-008 06/01/2020 ISLAND, SAN JUAN, SKAGIT, SNOHOMISH, AND WHATCOM COUNTIES Rates Fringes LABORER GROUP 1.....................$ 27.78 12.44 GROUP 2.....................$ 31.82 12.44 GROUP 3.....................$ 39.81 12.44 GROUP 4.....................$ 40.77 12.44 GROUP 5.....................$ 41.43 12.44 BASE POINTS: BELLINGHAM, MT. VERNON, EVERETT, SEATTLE, KENT, TACOMA, OLYMPIA, CENTRALIA, ABERDEEN, SHELTON, PT. TOWNSEND, PT. ANGELES, AND BREMERTON ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 but less than 45 radius miles from the respective city hall ZONE 3 - More than 45 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $1.00 ZONE 3 - $1.30 BASE POINTS: CHELAN, SUNNYSIDE, WENATCHEE, AND YAKIMA ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $2.25 LABORERS CLASSIFICATIONS GROUP 1: Landscaping and Planting; Watchman; Window Washer/Cleaner (detail clean-up, such as but not limited to cleaning floors, ceilings, walls, windows, etc., prior to final acceptance by the owner) GROUP 2: Batch Weighman; Crusher Feeder; Fence Laborer; Flagman; Pilot Car 31 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 32 GROUP 3: General Laborer; Air, Gas, or Electric Vibrating Screed; Asbestos Abatement Laborer; Ballast Regulator Machine; Brush Cutter; Brush Hog Feeder; Burner; Carpenter Tender; Cement Finisher Tender; Change House or Dry Shack; Chipping Gun (under 30 lbs.); Choker Setter; Chuck Tender; Clean-up Laborer; Concrete Form Stripper; Curing Laborer; Demolition (wrecking and moving including charred material); Ditch Digger; Dump Person; Fine Graders; Firewatch; Form Setter; Gabian Basket Builders; Grout Machine Tender; Grinders; Guardrail Erector; Hazardous Waste Worker (Level C: uses a chemical ""splash suit"" and air purifying respirator); Maintenance Person; Material Yard Person; Pot Tender; Rip Rap Person; Riggers; Scale Person; Sloper Sprayer; Signal Person; Stock Piler; Stake Hopper; Toolroom Man (at job site); Topper-Tailer; Track Laborer; Truck Spotter; Vinyl Seamer GROUP 4: Cement Dumper-Paving; Chipping Gun (over 30 lbs.); Clary Power Spreader; Concrete Dumper/Chute Operator; Concrete Saw Operator; Drill Operator (hydraulic, diamond, aiartrac); Faller and Bucker Chain Saw; Grade Checker and Transit Person; Groutmen (pressure) including post tension beams; Hazardous Waste Worker (Level B: uses same respirator protection as Level A. A supplied air line is provided in conjunction with a chemical ""splash suit""); High Scaler; Jackhammer; Laserbeam Operator; Manhole Builder-Mudman; Nozzleman (concrete pump, green cutter when using combination of high pressure air and water on concrete and rock, sandblast, gunite, shotcrete, water blaster, vacuum blaster); Pavement Breaker; Pipe Layer and Caulker; Pipe Pot Tender; Pipe Reliner (not insert type); Pipe Wrapper; Power Jacks; Railroad Spike Puller-Power; Raker-Asphalt; Rivet Buster; Rodder; Sloper (over 20 ft); Spreader (concrete); Tamper and Similar electric, air and glas operated tool; Timber Person-sewer (lagger shorer and cribber); Track Liner Power; Tugger Operator; Vibrator; Well Point Laborer GROUP 5: Caisson Worker; Miner; Mortarman and Hodcarrier; Powderman; Re-Timberman; Hazardous Waste Worker (Level A: utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line). 32 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 33 LABO0335-001 06/01/2020 CLARK, COWLITZ, KLICKITAT, PACIFIC (SOUTH OF A STRAIGHT LINE MADE BY EXTENDING THE NORTH BOUNDARY LINE OF WAHKIAKUM COUNTY WEST TO THE PACIFIC OCEAN), SKAMANIA AND WAHKIAKUM COUNTIES Rates Fringes Laborers: ZONE 1: GROUP 1....................$ 34.93 12.44 GROUP 2....................$ 35.65 12.44 GROUP 3....................$ 36.20 12.44 GROUP 4....................$ 36.66 12.44 GROUP 5....................$ 31.93 12.44 GROUP 6....................$ 29.01 12.44 GROUP 7....................$ 25.14 12.44 Zone Differential (Add to Zone 1 rates): Zone 2 $ 0.65 Zone 3 - 1.15 Zone 4 - 1.70 Zone 5 - 2.75 BASE POINTS: LONGVIEW AND VANCOUVER ZONE 1: Projects within 30 miles of the respective city all. ZONE 2: More than 30 miles but less than 40 miles from the respective city hall. ZONE 3: More than 40 miles but less than 50 miles from the respective city hall. ZONE 4: More than 50 miles but less than 80 miles from the respective city hall. ZONE 5: More than 80 miles from the respective city hall. LABORERS CLASSIFICATIONS GROUP 1: Asphalt Plant Laborers; Asphalt Spreaders; Batch Weighman; Broomers; Brush Burners and Cutters; Car and Truck Loaders; Carpenter Tender; Change-House Man or Dry Shack Man; Choker Setter; Clean-up Laborers; Curing, Concrete; Demolition, Wrecking and Moving Laborers; Dumpers, road oiling crew; Dumpmen (for grading crew); Elevator Feeders; Median Rail Reference Post, Guide Post, Right of Way Marker; Fine Graders; Fire Watch; Form Strippers (not swinging stages); General Laborers; Hazardous Waste Worker; Leverman or Aggregate Spreader (Flaherty and similar types); Loading Spotters; Material Yard Man (including electrical); Pittsburgh Chipper Operator or Similar Types; Railroad Track Laborers; Ribbon Setters (including steel forms); Rip Rap Man (hand placed); Road Pump Tender; Sewer Labor; Signalman; Skipman; Slopers; Spraymen; Stake Chaser; Stockpiler; Tie Back Shoring; Timber Faller and Bucker (hand labor); Toolroom Man (at job site); Tunnel Bullgang (above ground); Weight-Man- Crusher (aggregate when used) 33 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 34 GROUP 2: Applicator (including pot power tender for same), applying protective material by hand or nozzle on utility lines or storage tanks on project; Brush Cutters (power saw); Burners; Choker Splicer; Clary Power Spreader and similar types; Clean- up Nozzleman-Green Cutter (concrete, rock, etc.); Concrete Power Buggyman; Concrete Laborer; Crusher Feeder; Demolition and Wrecking Charred Materials; Gunite Nozzleman Tender; Gunite or Sand Blasting Pot Tender; Handlers or Mixers of all Materials of an irritating nature (including cement and lime); Tool Operators (includes but not limited to: Dry Pack Machine; Jackhammer; Chipping Guns; Paving Breakers); Pipe Doping and Wrapping; Post Hole Digger, air, gas or electric; Vibrating Screed; Tampers; Sand Blasting (Wet); Stake-Setter; Tunnel-Muckers, Brakemen, Concrete Crew, Bullgang (underground) GROUP 3: Asbestos Removal; Bit Grinder; Drill Doctor; Drill Operators, air tracks, cat drills, wagon drills, rubber-mounted drills, and other similar types including at crusher plants; Gunite Nozzleman; High Scalers, Strippers and Drillers (covers work in swinging stages, chairs or belts, under extreme conditions unusual to normal drilling, blasting, barring-down, or sloping and stripping); Manhole Builder; Powdermen; Concrete Saw Operator; Pwdermen; Power Saw Operators (Bucking and Falling); Pumpcrete Nozzlemen; Sand Blasting (Dry); Sewer Timberman; Track Liners, Anchor Machines, Ballast Regulators, Multiple Tampers, Power Jacks, Tugger Operator; Tunnel-Chuck Tenders, Nippers and Timbermen; Vibrator; Water Blaster GROUP 4: Asphalt Raker; Concrete Saw Operator (walls); Concrete Nozzelman; Grade Checker; Pipelayer; Laser Beam (pipelaying)-applicable when employee assigned to move, set up, align; Laser Beam; Tunnel Miners; Motorman-Dinky Locomotive-Tunnel; Powderman-Tunnel; Shield Operator-Tunnel GROUP 5: Traffic Flaggers GROUP 6: Fence Builders GROUP 7: Landscaping or Planting Laborers LABO0335-019 06/01/2020 Rates Fringes Hod Carrier......................$ 34.93 12.44 34 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 35 LABO0348-003 06/01/2020 CHELAN, DOUGLAS (W OF 12TH MERIDIAN), KITTITAS, AND YAKIMA COUNTIES Rates Fringes LABORER GROUP 1.....................$ 23.68 12.44 GROUP 2.....................$ 27.17 12.44 GROUP 3.....................$ 29.74 12.44 GROUP 4.....................$ 30.46 12.44 GROUP 5.....................$ 30.99 12.44 BASE POINTS: BELLINGHAM, MT. VERNON, EVERETT, SEATTLE, KENT, TACOMA, OLYMPIA, CENTRALIA, ABERDEEN, SHELTON, PT. TOWNSEND, PT. ANGELES, AND BREMERTON ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 but less than 45 radius miles from the respective city hall ZONE 3 - More than 45 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $1.00 ZONE 3 - $1.30 BASE POINTS: CHELAN, SUNNYSIDE, WENATCHEE, AND YAKIMA ZONE 1 - Projects within 25 radius miles of the respective city hall ZONE 2 - More than 25 radius miles from the respective city hall ZONE DIFFERENTIAL (ADD TO ZONE 1 RATES): ZONE 2 - $2.25 LABORERS CLASSIFICATIONS GROUP 1: Landscaping and Planting; Watchman; Window Washer/Cleaner (detail clean-up, such as but not limited to cleaning floors, ceilings, walls, windows, etc., prior to final acceptance by the owner) GROUP 2: Batch Weighman; Crusher Feeder; Fence Laborer; Flagman; Pilot Car 35 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 36 GROUP 3: General Laborer; Air, Gas, or Electric Vibrating Screed; Asbestos Abatement Laborer; Ballast Regulator Machine; Brush Cutter; Brush Hog Feeder; Burner; Carpenter Tender; Cement Finisher Tender; Change House or Dry Shack; Chipping Gun (under 30 lbs.); Choker Setter; Chuck Tender; Clean-up Laborer; Concrete Form Stripper; Curing Laborer; Demolition (wrecking and moving including charred material); Ditch Digger; Dump Person; Fine Graders; Firewatch; Form Setter; Gabian Basket Builders; Grout Machine Tender; Grinders; Guardrail Erector; Hazardous Waste Worker (Level C: uses a chemical ""splash suit"" and air purifying respirator); Maintenance Person; Material Yard Person; Pot Tender; Rip Rap Person; Riggers; Scale Person; Sloper Sprayer; Signal Person; Stock Piler; Stake Hopper; Toolroom Man (at job site); Topper-Tailer; Track Laborer; Truck Spotter; Vinyl Seamer GROUP 4: Cement Dumper-Paving; Chipping Gun (over 30 lbs.); Clary Power Spreader; Concrete Dumper/Chute Operator; Concrete Saw Operator; Drill Operator (hydraulic, diamond, aiartrac); Faller and Bucker Chain Saw; Grade Checker and Transit Person; Groutmen (pressure) including post tension beams; Hazardous Waste Worker (Level B: uses same respirator protection as Level A. A supplied air line is provided in conjunction with a chemical ""splash suit""); High Scaler; Jackhammer; Laserbeam Operator; Manhole Builder-Mudman; Nozzleman (concrete pump, green cutter when using combination of high pressure air and water on concrete and rock, sandblast, gunite, shotcrete, water blaster, vacuum blaster); Pavement Breaker; Pipe Layer and Caulker; Pipe Pot Tender; Pipe Reliner (not insert type); Pipe Wrapper; Power Jacks; Railroad Spike Puller-Power; Raker-Asphalt; Rivet Buster; Rodder; Sloper (over 20 ft); Spreader (concrete); Tamper and Similar electric, air and glas operated tool; Timber Person-sewer (lagger shorer and cribber); Track Liner Power; Tugger Operator; Vibrator; Well Point Laborer GROUP 5: Caisson Worker; Miner; Mortarman and Hodcarrier; Powderman; Re-Timberman; Hazardous Waste Worker (Level A: utilizes a fully encapsulated suit with a self-contained breathing apparatus or a supplied air line). 36 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 37 PAIN0005-002 07/01/2020 STATEWIDE EXCEPT CLARK, COWLITZ, KLICKITAT, PACIFIC (SOUTH), SKAMANIA, AND WAHKIAKUM COUNTIES Rates Fringes Painters: STRIPERS....................$ 31.90 17.23 PAIN0005-004 03/01/2009 CLALLAM, GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, LEWIS, MASON, PIERCE, SAN JUAN, SKAGIT, SNOHOMISH, THURSTON AND WHATCOM COUNTIES Rates Fringes PAINTER..........................$ 20.82 7.44 * PAIN0005-006 07/01/2018 ADAMS, ASOTIN; BENTON AND FRANKLIN (EXCEPT HANFORD SITE); CHELAN, COLUMBIA, DOUGLAS, FERRY, GARFIELD, GRANT, KITTITAS, LINCOLN, OKANOGAN, PEND OREILLE, SPOKANE, STEVENS, WALLA WALLA, WHITMAN AND YAKIMA COUNTIES Rates Fringes PAINTER Application of Cold Tar Products, Epoxies, Polyure thanes, Acids, Radiation Resistant Material, Water and Sandblasting............$ 30.19 Over 30'/Swing Stage Work..$ 22.20 Brush, Roller, Striping, Steam-cleaning and Spray....$ 22.94 Lead Abatement, Asbestos Abatement...................$ 21.50 11.71 7.98 11.61 7.98 *$.70 shall be paid over and above the basic wage rates listed for work on swing stages and high work of over 30 feet. 37 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 38 PAIN0055-003 07/01/2020 CLARK, COWLITZ, KLICKITAT, PACIFIC, SKAMANIA, AND WAHKIAKUM COUNTIES Rates Fringes PAINTER Brush & Roller..............$ 26.56 13.40 Spray and Sandblasting......$ 26.56 13.40 All high work over 60 ft. = base rate + $0.75 PAIN0055-006 03/01/2020 CLARK, COWLITZ, KLICKITAT, SKAMANIA and WAHKIAKUM COUNTIES Rates Fringes Painters: HIGHWAY & PARKING LOT STRIPER.....................$ 35.87 13.40 PLAS0072-004 06/01/2020 ADAMS, ASOTIN, BENTON, CHELAN, COLUMBIA, DOUGLAS, FERRY, FRANKLIN, GARFIELD, GRANT, KITTITAS, LINCOLN, OKANOGAN, PEND OREILLE, SPOKANE, STEVENS, WALLA WALLA, WHITMAN, AND YAKIMA COUNTIES Rates Fringes CEMENT MASON/CONCRETE FINISHER ZONE 1......................$ 31.30 15.53 Zone Differential (Add to Zone 1 rate): Zone 2 - $2.00 BASE POINTS: Spokane, Pasco, Lewiston; Wenatchee Zone 1: 0 - 45 radius miles from the main post office Zone 2: Over 45 radius miles from the main post office 38 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 39 PLAS0528-001 06/01/2020 CLALLAM, COWLITZ, GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, LEWIS, MASON, PACIFIC, PIERCE, SAN JUAN, SKAGIT, SNOHOMISH, THURSTON, WAHKIAKUM AND WHATCOM COUNTIES Rates Fringes CEMENT MASON CEMENT MASON................$ 45.80 18.54 COMPOSITION, TROWEL MACHINE, GRINDER, POWER TOOLS, GUNNITE NOZZLE.......$ 46.30 18.54 TROWELING MACHINE OPERATOR ON COMPOSITION..............$ 46.30 18.54 PLAS0555-002 07/01/2019 CLARK, KLICKITAT AND SKAMANIA COUNTIES ZONE 1: Rates Fringes CEMENT MASON CEMENT MASONS DOING BOTH COMPOSITION/POWER MACHINERY AND SUSPENDED/HANGING SCAFFOLD..$ 37.32 CEMENT MASONS ON 18.77 SUSPENDED, SWINGING AND/OR HANGING SCAFFOLD............$ 36.58 18.77 CEMENT MASONS...............$ 35.85 18.77 COMPOSITION WORKERS AND POWER MACHINERY OPERATORS...$ 36.58 18.77 Zone Differential (Add To Zone 1 Rates): Zone 2 - $0.65 Zone 3 -1.15 Zone 4 -1.70 Zone 5 -3.00 BASE POINTS: BEND, CORVALLIS, EUGENE, MEDFORD, PORTLAND, SALEM, THE DALLES, VANCOUVER ZONE 1: Projects within 30 miles of the respective city hall ZONE 2: More than 30 miles but less than 40 miles from the respective city hall. ZONE 3: More than 40 miles but less than 50 miles from the respective city hall. ZONE 4: More than 50 miles but less than 80 miles from the respective city hall. ZONE 5: More than 80 miles from the respective city hall 39 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 40 TEAM0037-002 06/01/2020 CLARK, COWLITZ, KLICKITAT, PACIFIC (South of a straight line made by extending the north boundary line of Wahkiakum County west to the Pacific Ocean), SKAMANIA, AND WAHKIAKUM COUNTIES Truck drivers: Rates Fringes ZONE 1 GROUP 1....................$ 29.33 16.40 GROUP 2....................$ 29.46 16.40 GROUP 3....................$ 29.60 16.40 GROUP 4....................$ 29.89 16.40 GROUP 5....................$ 30.03 16.40 GROUP 6....................$ 30.31 16.40 GROUP 7....................$ 30.53 16.40 Zone Differential (Add to Zone 1 Rates): Zone 2 - $0.65 Zone 3 -1.15 Zone 4 -1.70 Zone 5 -2.75 BASE POINTS: ASTORIA, THE DALLES, LONGVIEW AND VANCOUVER ZONE 1: Projects within 30 miles of the respective city hall. ZONE 2: More than 30 miles but less than 40 miles from the respective city hall. ZONE 3: More than 40 miles but less than 50 miles from the respective city hall. ZONE 4: More than 50 miles but less than 80 miles from the respective city hall. ZONE 5: More than 80 miles from the respective city hall. TRUCK DRIVERS CLASSIFICATIONS GROUP 1: A Frame or Hydra lifrt truck w/load bearing surface; Articulated Dump Truck; Battery Rebuilders; Bus or Manhaul Driver; Concrete Buggies (power operated); Concrete Pump Truck; Dump Trucks, side, end and bottom dumps, including Semi Trucks and Trains or combinations there of: up to and including 10 cu. yds.; Lift Jitneys, Fork Lifts (all sizes in loading, unloading and transporting material on job site); Loader and/or Leverman on Concrete Dry Batch Plant (manually operated); Pilot Car; Pickup Truck; Solo Flat Bed and misc. Body Trucks, 0-10 tons; Truck Tender; Truck Mechanic Tender; Water Wagons (rated capacity) up to 3,000 gallons; Transit Mix and Wet or Dry Mix - 5 cu. yds. and under; Lubrication Man, Fuel Truck Driver, Tireman, Wash Rack, Steam Cleaner or combinations; Team Driver; Slurry Truck Driver or Leverman; Tireman 40 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 41 GROUP 2: Boom Truck/Hydra-lift or Retracting Crane; Challenger; Dumpsters or similar equipment all sizes; Dump Trucks/Articulated Dumps 6 cu to 10 cu.; Flaherty Spreader Driver or Leverman; Lowbed Equipment, Flat Bed Semi-trailer or doubles transporting equipment or wet or dry materials; Lumber Carrier, Driver-Straddle Carrier (used in loading, unloading and transporting of materials on job site); Oil Distributor Driver or Leverman; Transit mix and wet or dry mix trcuks: over 5 cu. yds. and including 7 cu. yds.; Vacuum Trucks; Water truck/Wagons (rated capacity) over 3,000 to 5,000 gallons GROUP 3: Ammonia Nitrate Distributor Driver; Dump trucks, side, end and bottom dumps, including Semi Trucks and Trains or combinations thereof: over 10 cu. yds. and including 30 cu. yds. includes Articulated Dump Trucks; Self-Propelled Street Sweeper; Transit mix and wet or dry mix truck: over 7 cu yds. and including 11 cu yds.; Truck Mechanic-Welder-Body Repairman; Utility and Clean-up Truck; Water Wagons (rated capacity) over 5,000 to 10,000 gallons GROUP 4: Asphalt Burner; Dump Trucks, side, end and bottom cumps, including Semi-Trucks and Trains or combinations thereof: over 30 cu. yds. and including 50 cu. yds. includes Articulated Dump Trucks; Fire Guard; Transit Mix and Wet or Dry Mix Trucks, over 11 cu. yds. and including 15 cu. yds.; Water Wagon (rated capacity) over 10,000 gallons to 15,000 gallons GROUP 5: Composite Crewman; Dump Trucks, side, end and bottom dumps, including Semi Trucks and Trains or combinations thereof: over 50 cu. yds. and including 60 cu. yds. includes Articulated Dump Trucks GROUP 6: Bulk Cement Spreader w/o Auger; Dry Pre-Batch concrete Mix Trucks; Dump trucks, side, end and bottom dumps, including Semi Trucks and Trains of combinations thereof: over 60 cu. yds. and including 80 cu. yds., and includes Articulated Dump Trucks; Skid Truck GROUP 7: Dump Trucks, side, end and bottom dumps, including Semi Trucks and Trains or combinations thereof: over 80 cu. yds. and including 100 cu. yds., includes Articulated Dump Trucks; Industrial Lift Truck (mechanical tailgate) 41 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 42 * TEAM0174-001 06/01/2020 CLALLAM, GRAYS HARBOR, ISLAND, JEFFERSON, KING, KITSAP, LEWIS, MASON, PACIFIC (North of a straight line made by extending the north boundary line of Wahkiakum County west to the Pacific Ocean), PIERCE, SAN JUAN, SKAGIT, SNOHOMISH, THURSTON AND WHATCOM COUNTIES Rates Fringes Truck drivers: ZONE A: GROUP 1:...................$ 42.88 20.92 GROUP 2:...................$ 42.04 20.92 GROUP 3:...................$ 39.23 20.92 GROUP 4:...................$ 34.26 20.92 GROUP 5:...................$ 42.43 20.92 ZONE B (25-45 miles from center of listed cities*): Add $.70 per hour to Zone A rates. ZONE C (over 45 miles from centr of listed cities*): Add $1.00 per hour to Zone A rates. *Zone pay will be calculated from the city center of the following listed cities: BELLINGHAM CENTRALIA RAYMOND OLYMPIA EVERETT SHELTON ANACORTES BELLEVUE SEATTLE PORT ANGELES MT. VERNON KENT TACOMA PORT TOWNSEND ABERDEEN BREMERTON TRUCK DRIVERS CLASSIFICATIONS GROUP 1 - ""A-frame or Hydralift"" trucks and Boom trucks or similar equipment when ""A"" frame or ""Hydralift"" and Boom truck or similar equipment is used; Buggymobile; Bulk Cement Tanker; Dumpsters and similar equipment, Tournorockers, Tournowagon, Tournotrailer, Cat DW series, Terra Cobra, Le Tourneau, Westinghouse, Athye Wagon, Euclid Two and Four-Wheeled power tractor with trailer and similar top-loaded equipment transporting material: Dump Trucks, side, end and bottom dump, including semi-trucks and trains or combinations thereof with 16 yards to 30 yards capacity: Over 30 yards $.15 per hour additional for each 10 yard increment; Explosive Truck (field mix) and similar equipment; Hyster Operators (handling bulk loose aggregates); Lowbed and Heavy Duty Trailer; Road Oil Distributor Driver; Spreader, Flaherty Transit mix used exclusively in heavy construction; Water Wagon and Tank Truck-3,000 gallons and over capacity 42 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 43 GROUP 2 - Bulllifts, or similar equipment used in loading or unloading trucks, transporting materials on job site; Dumpsters, and similar equipment, Tournorockers, Tournowagon, Turnotrailer, Cat. D.W. Series, Terra Cobra, Le Tourneau, Westinghouse, Athye wagon, Euclid two and four-wheeled power tractor with trailer and similar top-loaded equipment transporting material: Dump trucks, side, end and bottom dump, including semi-trucks and trains or combinations thereof with less than 16 yards capacity; Flatbed (Dual Rear Axle); Grease Truck, Fuel Truck, Greaser, Battery Service Man and/or Tire Service Man; Leverman and loader at bunkers and batch plants; Oil tank transport; Scissor truck; Slurry Truck; Sno-Go and similar equipment; Swampers; Straddler Carrier (Ross, Hyster) and similar equipment; Team Driver; Tractor (small, rubber-tired)(when used within Teamster jurisdiction); Vacuum truck; Water Wagon and Tank trucks-less than 3,000 gallons capacity; Winch Truck; Wrecker, Tow truck and similar equipment GROUP 3 - Flatbed (single rear axle); Pickup Sweeper; Pickup Truck. (Adjust Group 3 upward by $2.00 per hour for onsite work only) GROUP 4 - Escort or Pilot Car GROUP 5 - Mechanic HAZMAT PROJECTS Anyone working on a HAZMAT job, where HAZMAT certification is required, shall be compensated as a premium, in addition to the classification working in as follows: LEVEL C: +$.25 per hour - This level uses an air purifying respirator or additional protective clothing. LEVEL B: +$.50 per hour - Uses same respirator protection as Level A. Supplied air line is provided in conjunction with a chemical ""splash suit."" LEVEL A: +$.75 per hour - This level utilizes a fully- encapsulated suit with a self-contained breathing apparatus or a supplied air line. 43 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 44 TEAM0690-004 01/01/2019 ADAMS, ASOTIN, BENTON, CHELAN, COLUMBIA, DOUGLAS, FERRY, FRANKLIN, GARFIELD, GRANT KITTITAS, LINCOLN, OKANOGAN, PEND OREILLE, SPOKANE, STEVENS, WALLA WALLA, WHITMAN AND YAKIMA COUNTIES Rates Fringes Truck drivers: (AREA 1: SPOKANE ZONE CENTER: Adams, Chelan, Douglas, Ferry, Grant, Kittitas, Lincoln, Okanogan, Pen Oreille, Spokane, Stevens, and Whitman Counties AREA 1: LEWISTON ZONE CENTER: Asotin, Columbia, and Garfield Counties AREA 2: PASCO ZONE CENTER: Benton, Franklin, Walla Walla and Yakima Counties) AREA 1: GROUP 1....................$ 23.91 17.40 GROUP 2....................$ 26.18 17.40 GROUP 3....................$ 26.68 17.40 GROUP 4....................$ 27.01 17.40 GROUP 5....................$ 27.12 17.40 GROUP 6....................$ 27.29 17.40 GROUP 7....................$ 27.82 17.40 GROUP 8....................$ 28.18 17.40 AREA 2: GROUP 1....................$ 26.05 17.40 GROUP 2....................$ 28.69 17.40 GROUP 3....................$ 28.80 17.40 GROUP 4....................$ 29.13 17.40 GROUP 5....................$ 29.24 17.40 GROUP 6....................$ 29.24 17.40 GROUP 7....................$ 29.78 17.40 GROUP 8....................$ 30.10 17.40 Zone Differential (Add to Zone 1 rate: Zone 1 + $2.00) BASE POINTS: Spokane, Pasco, Lewiston Zone 1: 0-45 radius miles from the main post office. Zone 2: Outside 45 radius miles from the main post office 44 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 45 TRUCK DRIVERS CLASSIFICATIONS GROUP 1: Escort Driver or Pilot Car; Employee Haul; Power Boat Hauling Employees or Material GROUP 2: Fish Truck; Flat Bed Truck; Fork Lift (3000 lbs. and under); Leverperson (loading trucks at bunkers); Trailer Mounted Hydro Seeder and Mulcher; Seeder & Mulcher; Stationary Fuel Operator; Tractor (small, rubber-tired, pulling trailer or similar equipment) GROUP 3: Auto Crane (2000 lbs. capacity); Buggy Mobile & Similar; Bulk Cement Tanks & Spreader; Dumptor (6 yds. & under); Flat Bed Truck with Hydraullic System; Fork Lift (3001-16,000 lbs.); Fuel Truck Driver, Steamcleaner & Washer; Power Operated Sweeper; Rubber-tired Tunnel Jumbo; Scissors Truck; Slurry Truck Driver; Straddle Carrier (Ross, Hyster, & similar); Tireperson; Transit Mixers & Truck Hauling Concrete (3 yd. to & including 6 yds.); Trucks, side, end, bottom & articulated end dump (3 yards to and including 6 yds.); Warehouseperson (to include shipping & receiving); Wrecker & Tow Truck GROUP 4: A-Frame; Burner, Cutter, & Welder; Service Greaser; Trucks, side, end, bottom & articulated end dump (over 6 yards to and including 12 yds.); Truck Mounted Hydro Seeder; Warehouseperson; Water Tank truck (0-8,000 gallons) GROUP 5: Dumptor (over 6 yds.); Lowboy (50 tons & under); Self- loading Roll Off; Semi-Truck & Trailer; Tractor with Steer Trailer; Transit Mixers and Trucks Hauling Concrete (over 6 yds. to and including 10 yds.); Trucks, side, end, bottom and end dump (over 12 yds. to & including 20 yds.); Truck-Mounted Crane (with load bearing surface either mounted or pulled, up to 14 ton); Vacuum Truck (super sucker, guzzler, etc.) GROUP 6: Flaherty Spreader Box Driver; Flowboys; Fork Lift (over 16,000 lbs.); Dumps (Semi-end); Mechanic (Field); Semi- end Dumps; Transfer Truck & Trailer; Transit Mixers & Trucks Hauling Concrete (over 10 yds. to & including 20 yds.); Trucks, side, end, bottom and articulated end dump (over 20 yds. to & including 40 yds.); Truck and Pup; Tournarocker, DWs & similar with 2 or more 4 wheel-power tractor with trailer, gallonage or yardage scale, whichever is greater Water Tank Truck (8,001- 14,000 gallons); Lowboy(over 50 tons) GROUP 7: Oil Distributor Driver; Stringer Truck (cable oeprated trailer); Transit Mixers & Trucks Hauling Concrete (over 20 yds.); Truck, side, end, bottom end dump (over 40 yds. to & including 100 yds.); Truck Mounted Crane (with load bearing surface either mounted or pulled (16 through 25 tons); 45 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- ---------------------------------------------------------------- Page | 46 GROUP 8: Prime Movers and Stinger Truck; Trucks, side, end, bottom and articulated end dump (over 100 yds.); Helicopter Pilot Hauling Employees or Materials Footnote A - Anyone working on a HAZMAT job, where HAZMAT certification is required, shall be compensated as a premium, in additon to the classification working in as follows: LEVEL C-D: - $.50 PER HOUR (This is the lowest level of protection. This level may use an air purifying respirator or additional protective clothing. LEVEL A-B: - $1.00 PER HOUR (Uses supplied air is conjunction with a chemical spash suit or fully encapsulated suit with a self-contained breathing apparatus. Employees shall be paid Hazmat pay in increments of four(4) and eight(8) hours. NOTE: Trucks Pulling Equipment Trailers: shall receive $.15/hour over applicable truck rate WELDERS - Receive rate prescribed for craft performing operation to which welding is incidental. ================================================================ Note: Executive Order (EO) 13706, Establishing Paid Sick Leave for Federal Contractors applies to all contracts subject to the Davis-Bacon Act for which the contract is awarded (and any solicitation was issued) on or after January 1, 2017. If this contract is covered by the EO, the contractor must provide employees with 1 hour of paid sick leave for every 30 hours they work, up to 56 hours of paid sick leave each year. Employees must be permitted to use paid sick leave for their own illness, injury or other health-related needs, including preventive care; to assist a family member (or person who is like family to the employee) who is ill, injured, or has other health-related needs, including preventive care; or for reasons resulting from, or to assist a family member (or person who is like family to the employee) who is a victim of, domestic violence, sexual assault, or stalking. Additional information on contractor requirements and worker protections under the EO is available at www.dol.gov/whd/govcontracts. Unlisted classifications needed for work not included within the scope of the classifications listed may be added after award only as provided in the labor standards contract clauses (29CFR 5.5 (a) (1) (ii)). 46 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 47 The body of each wage determination lists the classification and wage rates that have been found to be prevailing for the cited type(s) of construction in the area covered by the wage determination. The classifications are listed in alphabetical order of ""identifiers"" that indicate whether the particular rate is a union rate (current union negotiated rate for local), a survey rate (weighted average rate) or a union average rate (weighted union average rate). Union Rate Identifiers A four letter classification abbreviation identifier enclosed in dotted lines beginning with characters other than ""SU"" or ""UAVG"" denotes that the union classification and rate were prevailing for that classification in the survey. Example: PLUM0198-005 07/01/2014. PLUM is an abbreviation identifier of the union which prevailed in the survey for this classification, which in this example would be Plumbers. 0198 indicates the local union number or district council number where applicable, i.e., Plumbers Local 0198. The next number, 005 in the example, is an internal number used in processing the wage determination. 07/01/2014 is the effective date of the most current negotiated rate, which in this example is July 1, 2014. Union prevailing wage rates are updated to reflect all rate changes in the collective bargaining agreement (CBA) governing this classification and rate. Survey Rate Identifiers Classifications listed under the ""SU"" identifier indicate that no one rate prevailed for this classification in the survey and the published rate is derived by computing a weighted average rate based on all the rates reported in the survey for that classification. As this weighted average rate includes all rates reported in the survey, it may include both union and non-union rates. Example: SULA2012-007 5/13/2014. SU indicates the rates are survey rates based on a weighted average calculation of rates and are not majority rates. LA indicates the State of Louisiana. 2012 is the year of survey on which these classifications and rates are based. The next number, 007 in the example, is an internal number used in producing the wage determination. 5/13/2014 indicates the survey completion date for the classifications and rates under that identifier. Survey wage rates are not updated and remain in effect until a new survey is conducted. Union Average Rate Identifiers Classification(s) listed under the UAVG identifier indicate that no single majority rate prevailed for those classifications; however, 100% of the data reported for the 47 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           ---------------------------------------------------------------- Page | 48 classifications was union data. EXAMPLE: UAVG-OH-0010 08/29/2014. UAVG indicates that the rate is a weighted union average rate. OH indicates the state. The next number, 0010 in the example, is an internal number used in producing the wage determination. 08/29/2014 indicates the survey completion date for the classifications and rates under that identifier. A UAVG rate will be updated once a year, usually in January of each year, to reflect a weighted average of the current negotiated/CBA rate of the union locals from which the rate is based. WAGE DETERMINATION APPEALS PROCESS 1.) Has there been an initial decision in the matter? This can be: * an existing published wage determination * a survey underlying a wage determination * a Wage and Hour Division letter setting forth a position on a wage determination matter * a conformance (additional classification and rate) ruling On survey related matters, initial contact, including requests for summaries of surveys, should be with the Wage and Hour Regional Office for the area in which the survey was conducted because those Regional Offices have responsibility for the Davis-Bacon survey program. If the response from this initial contact is not satisfactory, then the process described in 2.) and 3.) should be followed. With regard to any other matter not yet ripe for the formal process described here, initial contact should be with the Branch of Construction Wage Determinations. Write to: Branch of Construction Wage Determinations Wage and Hour Division U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 48 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction                           Page | 49 2.) If the answer to the question in 1.) is yes, then an interested party (those affected by the action) can request review and reconsideration from the Wage and Hour Administrator (See 29 CFR Part 1.8 and 29 CFR Part 7). Write to: Wage and Hour Administrator U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 The request should be accompanied by a full statement of the interested party's position and by any information (wage payment data, project description, area practice material, etc.) that the requestor considers relevant to the issue. 3.) If the decision of the Administrator is not favorable, an interested party may appeal directly to the Administrative Review Board (formerly the Wage Appeals Board). Write to: Administrative Review Board U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 4.) All decisions by the Administrative Review Board are final. ================================================================ END OF GENERAL DECISION" 49 | Page WA20210001 Modification 2 Federal Wage Determinations for Highway Construction